Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-C1orf25 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysateTRMT1L is supported by BioGPS gene expression data to be expressed in ACHN)

Rabbit C1orf25 Polyclonal Antibody | anti-TRMT1L antibody

C1orf25 antibody - middle region

Gene Names
TRMT1L; TRM1L; MST070; C1orf25; MSTP070; bG120K12.3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C1orf25; Polyclonal Antibody; C1orf25 antibody - middle region; anti-TRMT1L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QFKSILLKYSTPTYTGGQSESHVQSASEDTVTERVEMSVNDKAEASGCRR
Sequence Length
733
Applicable Applications for anti-TRMT1L antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C1orf25
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-C1orf25 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysateTRMT1L is supported by BioGPS gene expression data to be expressed in ACHN)

Western Blot (WB) (WB Suggested Anti-C1orf25 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysateTRMT1L is supported by BioGPS gene expression data to be expressed in ACHN)
Related Product Information for anti-TRMT1L antibody
This is a rabbit polyclonal antibody against C1orf25. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Although C1orf25 is similar to N2,N2-dimethylguanosine tRNA methyltransferase from other organisms, the true function of C1orf25 protein is not known.
Product Categories/Family for anti-TRMT1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
TRMT1-like protein isoform 1
NCBI Official Synonym Full Names
tRNA methyltransferase 1 like
NCBI Official Symbol
TRMT1L
NCBI Official Synonym Symbols
TRM1L; MST070; C1orf25; MSTP070; bG120K12.3
NCBI Protein Information
TRMT1-like protein
UniProt Protein Name
TRMT1-like protein
Protein Family
UniProt Gene Name
TRMT1L
UniProt Synonym Gene Names
C1orf25; TRM1L; MSTP070
UniProt Entry Name
TRM1L_HUMAN

NCBI Description

This gene encodes a protein that has some similarity to N2,N2-dimethylguanosine tRNA methyltransferase from other organisms. Studies of the mouse ortholog have shown that this protein plays a role in motor coordination and exploratory behavior, and it may also be involved in modulating postnatal neuronal functions. Alternatively spliced transcripts have been identified for this gene. [provided by RefSeq, Jan 2011]

Research Articles on TRMT1L

Similar Products

Product Notes

The TRMT1L trmt1l (Catalog #AAA3204766) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C1orf25 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C1orf25 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRMT1L trmt1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QFKSILLKYS TPTYTGGQSE SHVQSASEDT VTERVEMSVN DKAEASGCRR. It is sometimes possible for the material contained within the vial of "C1orf25, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.