Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit C1ORF166 Polyclonal Antibody | anti-C1ORF166 antibody

C1ORF166 antibody

Gene Names
MUL1; GIDE; MAPL; MULAN; RNF218; C1orf166
Applications
Western Blot
Purity
Affinity purified
Synonyms
C1ORF166; Polyclonal Antibody; C1ORF166 antibody; Polyclonal C1ORF166; Anti-C1ORF166; Chromosome ORF 1; FLJ12875; Chromosome 1 ORF; Chromosome ORF-1; RP11-401M16.2; anti-C1ORF166 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
C1ORF166 antibody was raised against the middle region of C1Orf166
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF166 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
79
Applicable Applications for anti-C1ORF166 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
C1orf166 encodes an ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Cross-Reactivity
Human
Immunogen
C1ORF166 antibody was raised using the middle region of C1Orf166 corresponding to a region with amino acids KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-C1ORF166 antibody
Rabbit polyclonal C1ORF166 antibody raised against the middle region of C1Orf166
Product Categories/Family for anti-C1ORF166 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
40 kDa (MW of target protein)
NCBI Official Full Name
chromosome 1 open reading frame 166, isoform CRA_c, partial
NCBI Official Synonym Full Names
mitochondrial E3 ubiquitin protein ligase 1
NCBI Official Symbol
MUL1
NCBI Official Synonym Symbols
GIDE; MAPL; MULAN; RNF218; C1orf166
NCBI Protein Information
mitochondrial ubiquitin ligase activator of NFKB 1
UniProt Protein Name
Mitochondrial ubiquitin ligase activator of NFKB 1
UniProt Gene Name
MUL1
UniProt Synonym Gene Names
C1orf166; GIDE; MAPL; MULAN; RNF218; MAPL
UniProt Entry Name
MUL1_HUMAN

Uniprot Description

MULAN: Exhibits weak E3 ubiquitin-protein ligase activity, but preferentially acts as a SUMO E3 ligase at physiological concentrations. Plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Protein type: Ubiquitin conjugating system; Membrane protein, multi-pass; Membrane protein, integral; EC 6.3.2.-; Mitochondrial; EC 6.3.2.19; Ligase; Ubiquitin ligase; Apoptosis

Chromosomal Location of Human Ortholog: 1p36.12

Cellular Component: nucleoplasm; membrane; mitochondrion; cytoplasm; peroxisome; integral to mitochondrial outer membrane

Molecular Function: identical protein binding; protein binding; signal transducer activity; zinc ion binding; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; SUMO ligase activity; ligase activity

Biological Process: caspase activation; mitochondrial fission; positive regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of protein kinase B signaling cascade; protein stabilization; protein ubiquitination; negative regulation of defense response to virus by host; mitochondrion localization; activation of JNK activity; positive regulation of protein sumoylation; protein sumoylation; negative regulation of innate immune response; negative regulation of cell growth

Research Articles on C1ORF166

Similar Products

Product Notes

The C1ORF166 mul1 (Catalog #AAA5303029) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C1ORF166 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C1ORF166 mul1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C1ORF166, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.