Rabbit anti-Human, Mouse C1ORF151 Polyclonal Antibody | anti-C1ORF151 antibody

C1ORF151 antibody

Cat. Num. AAA839071

• Gene Names: MINOS1; MIO10; Mic10; C1orf151
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: C1ORF151; Polyclonal Antibody; C1ORF151 antibody; Polyclonal C1ORF151; Anti-C1ORF151; Chromosome ORF 1; Chromosome ORF-1; FLJ36999; Chromosome 1 ORF; anti-C1ORF151 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Specificity: C1ORF151 antibody was raised against the middle region of C1Orf151
• Purity/Purification: Affinity purified
• Form/Format: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF151 antibody in PBS
• Concentration: 1 mg/ml (varies by lot)
• Sequence Length: 39

• Applicable Applications for anti-C1ORF151 antibody: Western Blot (WB)
• Application Notes: WB: 1 ug/ml
• Biological Significance: The function of C1orf151 protein has not been widely studied, and is yet to be fully elucidated.
• Cross-Reactivity: Human,Mouse
• Immunogen: C1ORF151 antibody was raised using the middle region of C1Orf151 corresponding to a region with amino acids IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
• Preparation and Storage: Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C1ORF151 antibody (MBS839071) used at 1 ug/ml to detect target protein.)

Related Product Information for anti-C1ORF151 antibody

Rabbit polyclonal C1ORF151 antibody raised against the middle region of C1Orf151

Product Categories/Family for anti-C1ORF151 antibody

DNA & RNA; Purified Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 14602856
• NCBI GeneID: 440574
• Molecular Weight: 9 kDa (MW of target protein)
• NCBI Official Full Name: C1orf151 protein, partial
• NCBI Official Synonym Full Names: mitochondrial inner membrane organizing system 1
• NCBI Official Symbol: MINOS1
• NCBI Official Synonym Symbols: MIO10; Mic10; C1orf151
• NCBI Protein Information: MICOS complex subunit MIC10
• UniProt Protein Name: MICOS complex subunit MIC10
• UniProt Gene Name: MINOS1
• UniProt Synonym Gene Names: C1orf151; MIC10
• UniProt Entry Name: MIC10_HUMAN

Uniprot Description

MINOS1: May play a role in mitochondrial architecture. Belongs to the mitochondrial organizing structure protein type 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Mitochondrial

Chromosomal Location of Human Ortholog: 1p36.13

Cellular Component: mitochondrion; mitochondrial inner membrane; integral to membrane