Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C15ORF15 antibody (MBS5300513) used at 0.0625 ug/ml to detect target protein.)

Rabbit C15ORF15 Polyclonal Antibody | anti-C15ORF15 antibody

C15ORF15 antibody

Gene Names
RSL24D1; L30; RLP24; RPL24; TVAS3; RPL24L; C15orf15; HRP-L30-iso
Applications
Western Blot
Purity
Affinity purified
Synonyms
C15ORF15; Polyclonal Antibody; C15ORF15 antibody; Polyclonal C15ORF15; Anti-C15ORF15; Chromosome ORF 15; RPL24L; HRP-L30-iso; Chromosome 15 ORF; RPL24; L30; Chromosome ORF-15; RLP24; anti-C15ORF15 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
C15ORF15 antibody was raised against the middle region of C15Orf15
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C15ORF15 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
163
Applicable Applications for anti-C15ORF15 antibody
Western Blot (WB)
Application Notes
WB: 0.0625 ug/ml
Biological Significance
The function of Chromosome 15 ORF protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human
Immunogen
C15ORF15 antibody was raised using the middle region of C15Orf15 corresponding to a region with amino acids FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C15ORF15 antibody (MBS5300513) used at 0.0625 ug/ml to detect target protein.)

Western Blot (WB) (C15ORF15 antibody (MBS5300513) used at 0.0625 ug/ml to detect target protein.)
Related Product Information for anti-C15ORF15 antibody
Rabbit polyclonal C15ORF15 antibody raised against the middle region of C15Orf15
Product Categories/Family for anti-C15ORF15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
19 kDa (MW of target protein)
NCBI Official Full Name
C15orf15
NCBI Official Synonym Full Names
ribosomal L24 domain containing 1
NCBI Official Symbol
RSL24D1
NCBI Official Synonym Symbols
L30; RLP24; RPL24; TVAS3; RPL24L; C15orf15; HRP-L30-iso
NCBI Protein Information
probable ribosome biogenesis protein RLP24
UniProt Protein Name
Probable ribosome biogenesis protein RLP24
UniProt Gene Name
RSL24D1
UniProt Synonym Gene Names
C15orf15; RPL24L
UniProt Entry Name
RLP24_HUMAN

NCBI Description

This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes. [provided by RefSeq, Jul 2012]

Uniprot Description

RSL24D1: Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of GTPBP4/NOG1 to pre-60S particles. Belongs to the ribosomal protein L24e family.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 15q21

Cellular Component: nucleolus; nucleus

Biological Process: ribosome biogenesis and assembly

Research Articles on C15ORF15

Similar Products

Product Notes

The C15ORF15 rsl24d1 (Catalog #AAA5300513) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C15ORF15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.0625 ug/ml. Researchers should empirically determine the suitability of the C15ORF15 rsl24d1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C15ORF15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.