Rabbit C14ORF172 Polyclonal Antibody | anti-C14ORF172 antibody
C14ORF172 antibody
Gene Names
TRMT61A; GCD14; TRM61; Gcd14p; hTRM61; C14orf172
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
C14ORF172; Polyclonal Antibody; C14ORF172 antibody; Polyclonal C14ORF172; Anti-C14ORF172; FLJ40452; GCD14; Gcd14p; Chromosome ORF-14; TRM61; Chromosome ORF 14; Chromosome 14 ORF; anti-C14ORF172 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
C14ORF172 antibody was raised against the N terminal Of C14Orf172
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C14ORF172 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
197
Applicable Applications for anti-C14ORF172 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
C14ORF172 antibody was raised using the N terminal Of C14Orf172 corresponding to a region with amino acids MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-C14ORF172 antibody
Rabbit polyclonal C14ORF172 antibody raised against the N terminal Of C14Orf172
Product Categories/Family for anti-C14ORF172 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
31 kDa (MW of target protein)
NCBI Official Full Name
chromosome 14 open reading frame 172, isoform CRA_a, partial
NCBI Official Synonym Full Names
tRNA methyltransferase 61A
NCBI Official Symbol
TRMT61A
NCBI Official Synonym Symbols
GCD14; TRM61; Gcd14p; hTRM61; C14orf172
NCBI Protein Information
tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
UniProt Protein Name
tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
UniProt Gene Name
TRMT61A
UniProt Synonym Gene Names
C14orf172; TRM61; tRNA(m1A58)MTase subunit TRMT61A
UniProt Entry Name
TRM61_HUMAN
Uniprot Description
TRMT61A: Catalytic subunit of tRNA (adenine-N(1)-)- methyltransferase, which catalyzes the formation of N(1)- methyladenine at position 58 (m1A58) in initiator methionyl-tRNA. Belongs to the methyltransferase superfamily. TRM61 family.
Protein type: Methyltransferase; EC 2.1.1.220
Chromosomal Location of Human Ortholog: 14q32
Cellular Component: nucleus
Molecular Function: tRNA (adenine-N1-)-methyltransferase activity
Biological Process: tRNA methylation
Similar Products
Product Notes
The C14ORF172 trmt61a (Catalog #AAA5301163) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C14ORF172 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C14ORF172 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C14ORF172 trmt61a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C14ORF172, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
