Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0ug/ml using anti-BXDC5 antibody )

Rabbit BXDC5 Polyclonal Antibody | anti-RPF1 antibody

BXDC5 antibody - N-terminal region

Gene Names
RPF1; BXDC5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
BXDC5; Polyclonal Antibody; BXDC5 antibody - N-terminal region; anti-RPF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD
Sequence Length
349
Applicable Applications for anti-RPF1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BXDC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0ug/ml using anti-BXDC5 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0ug/ml using anti-BXDC5 antibody )

Western Blot (WB)

(WB Suggested Anti-BXDC5 Antibody Titration: 0.2-1 ug/mlPositive Control: K562 cell lysate)

Western Blot (WB) (WB Suggested Anti-BXDC5 Antibody Titration: 0.2-1 ug/mlPositive Control: K562 cell lysate)
Related Product Information for anti-RPF1 antibody
This is a rabbit polyclonal antibody against BXDC5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BXDC5 may be required for ribosome biogenesis.
Product Categories/Family for anti-RPF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
ribosome production factor 1
NCBI Official Synonym Full Names
ribosome production factor 1 homolog
NCBI Official Symbol
RPF1
NCBI Official Synonym Symbols
BXDC5
NCBI Protein Information
ribosome production factor 1
UniProt Protein Name
Ribosome production factor 1
UniProt Gene Name
RPF1
UniProt Synonym Gene Names
BXDC5
UniProt Entry Name
RPF1_HUMAN

Similar Products

Product Notes

The RPF1 rpf1 (Catalog #AAA3205601) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BXDC5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's BXDC5 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RPF1 rpf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAAFPPGFSI SEIKNKQRRH LMFTRWKQQQ RKEKLAAKKK LKKEREALGD. It is sometimes possible for the material contained within the vial of "BXDC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.