Western Blot (WB)
(BTNL3 polyclonal antibody. Western Blot analysis of BTNL3 expression in HepG2.)
Mouse anti-Human BTNL3 Polyclonal Antibody | anti-BTNL3 antibody
BTNL3 (BTNLR, COLF4100, Butyrophilin-like Protein 3, Butyrophilin-like Receptor)
Gene Names
BTNL3; BTNLR
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
BTNL3; Polyclonal Antibody; BTNL3 (BTNLR; COLF4100; Butyrophilin-like Protein 3; Butyrophilin-like Receptor); Anti -BTNL3 (BTNLR; anti-BTNL3 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BTNL3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAFVLILVLSFYELVSGQWQVTGPGKFVQALVGEDAVFSCSLFPETSAEAMEVRFFRNQFHAVVHLYRDGEDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQIYDEEATWELRVAALGSLPLISIVGYVDGGIQLLCLSSGWFPQPTAKWKGPQGQDLSSDSRANADGYSLYDVEISIIVQENAGSILCSIHLAEQSHEVESKVLIGETFFQPSPWRLASILLGLLCGALCGVVMGMIIVFFKSKGKIQAELDWRRKHGQAELRDARKHAVEVTLDPETAHPKLCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQGFQAGKHYWEVDVGQNVGWYVGVCRDDVDRGKNNVTLSPNNGYWVLRLTTEHLYFTFNPHFISLPPSTPPTRVGVFLDYEGGTISFFNTNDQSLIYTLLTCQFEGLLRPYIQHAMYDEEKGTPIFICPVSWG
Applicable Applications for anti-BTNL3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human BTNL3, aa1-466 (NP_932079.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(BTNL3 polyclonal antibody. Western Blot analysis of BTNL3 expression in HepG2.)
Western Blot (WB)
(BTNL3 polyclonal antibody. Western Blot analysis of BTNL3 expression in HepG2.)
Western Blot (WB)
(Western Blot analysis of BTNL3 expression in transfected 293T cell line by BTNL3 polyclonal antibody. Lane1: BTNL3 transfected lysate (51.26kD). Lane2:Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of BTNL3 expression in transfected 293T cell line by BTNL3 polyclonal antibody. Lane1: BTNL3 transfected lysate (51.26kD). Lane2:Non-transfected lysate.)
Related Product Information for anti-BTNL3 antibody
BTNL3 is expressed in small intestine, colon, testis, spleen, and leukocyte and plays a role in lipid metabolism. Two isoforms have been described.
Product Categories/Family for anti-BTNL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,251 Da
NCBI Official Full Name
butyrophilin-like protein 3
NCBI Official Synonym Full Names
butyrophilin-like 3
NCBI Official Symbol
BTNL3
NCBI Official Synonym Symbols
BTNLR
NCBI Protein Information
butyrophilin-like protein 3; butyrophilin-like receptor
UniProt Protein Name
Butyrophilin-like protein 3
Protein Family
UniProt Gene Name
BTNL3
UniProt Synonym Gene Names
BTNLR; COLF4100
UniProt Entry Name
BTNL3_HUMAN
Uniprot Description
BTNL3: Belongs to the immunoglobulin superfamily. BTN/MOG family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Receptor, misc.; Membrane protein, integral
Chromosomal Location of Human Ortholog: 5q35.3
Cellular Component: integral to membrane
Similar Products
Product Notes
The BTNL3 btnl3 (Catalog #AAA645418) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BTNL3 (BTNLR, COLF4100, Butyrophilin-like Protein 3, Butyrophilin-like Receptor) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BTNL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the BTNL3 btnl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAFVLILVLS FYELVSGQWQ VTGPGKFVQA LVGEDAVFSC SLFPETSAEA MEVRFFRNQF HAVVHLYRDG EDWESKQMPQ YRGRTEFVKD SIAGGRVSLR LKNITPSDIG LYGCWFSSQI YDEEATWELR VAALGSLPLI SIVGYVDGGI QLLCLSSGWF PQPTAKWKGP QGQDLSSDSR ANADGYSLYD VEISIIVQEN AGSILCSIHL AEQSHEVESK VLIGETFFQP SPWRLASILL GLLCGALCGV VMGMIIVFFK SKGKIQAELD WRRKHGQAEL RDARKHAVEV TLDPETAHPK LCVSDLKTVT HRKAPQEVPH SEKRFTRKSV VASQGFQAGK HYWEVDVGQN VGWYVGVCRD DVDRGKNNVT LSPNNGYWVL RLTTEHLYFT FNPHFISLPP STPPTRVGVF LDYEGGTISF FNTNDQSLIY TLLTCQFEGL LRPYIQHAMY DEEKGTPIFI CPVSWG. It is sometimes possible for the material contained within the vial of "BTNL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
