Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BTN1A1Sample Tissue: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human BTN1A1 Polyclonal Antibody | anti-BTN1A1 antibody

BTN1A1 Antibody - middle region

Gene Names
BTN1A1; BT; BTN; BTN1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BTN1A1; Polyclonal Antibody; BTN1A1 Antibody - middle region; anti-BTN1A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERRNEFSSKERLLEELKW
Sequence Length
526
Applicable Applications for anti-BTN1A1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BTN1A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BTN1A1Sample Tissue: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BTN1A1Sample Tissue: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-BTN1A1 antibody
Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families
Product Categories/Family for anti-BTN1A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
696
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
butyrophilin subfamily 1 member A1
NCBI Official Synonym Full Names
butyrophilin subfamily 1 member A1
NCBI Official Symbol
BTN1A1
NCBI Official Synonym Symbols
BT; BTN; BTN1
NCBI Protein Information
butyrophilin subfamily 1 member A1
UniProt Protein Name
Butyrophilin subfamily 1 member A1
Protein Family
UniProt Gene Name
BTN1A1
UniProt Synonym Gene Names
BTN; BT

NCBI Description

Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families [provided by RefSeq, Jul 2008]

Uniprot Description

May function in the secretion of milk-fat droplets. May act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane (). Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion ().

Research Articles on BTN1A1

Similar Products

Product Notes

The BTN1A1 btn1a1 (Catalog #AAA3219678) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BTN1A1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BTN1A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BTN1A1 btn1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WIVAVAVILM VLGLLTIGSI FFTWRLYNER PRERRNEFSS KERLLEELKW. It is sometimes possible for the material contained within the vial of "BTN1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.