Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BST1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Rabbit BST1 Polyclonal Antibody | anti-BST1 antibody

BST1 antibody - middle region

Gene Names
BST1; CD157
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BST1; Polyclonal Antibody; BST1 antibody - middle region; anti-BST1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSC
Sequence Length
318
Applicable Applications for anti-BST1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 79%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BST1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Western Blot (WB) (WB Suggested Anti-BST1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Related Product Information for anti-BST1 antibody
This is a rabbit polyclonal antibody against BST1. It was validated on Western Blot

Target Description: Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
683
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
NCBI Official Synonym Full Names
bone marrow stromal cell antigen 1
NCBI Official Symbol
BST1
NCBI Official Synonym Symbols
CD157
NCBI Protein Information
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
UniProt Protein Name
ADP-ribosyl cyclase 2
Protein Family
UniProt Gene Name
BST1
UniProt Synonym Gene Names
BST-1
UniProt Entry Name
BST1_HUMAN

NCBI Description

Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. [provided by RefSeq, Jul 2008]

Uniprot Description

BST1: Synthesizes cyclic ADP-ribose, a second messenger that elicits calcium release from intracellular stores. May be involved in pre-B-cell growth. Belongs to the ADP-ribosyl cyclase family.

Protein type: Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; Hydrolase; EC 3.2.2.6; Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 4p15

Cellular Component: extrinsic to membrane; plasma membrane

Molecular Function: transferase activity; phosphorus-oxygen lyase activity; NAD+ nucleosidase activity; NAD(P)+ nucleosidase activity

Biological Process: metabolic process; multicellular organismal development; positive regulation of B cell proliferation; humoral immune response

Research Articles on BST1

Similar Products

Product Notes

The BST1 bst1 (Catalog #AAA3215278) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BST1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BST1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BST1 bst1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FWENSHLLVN SFADNTRRFM PLSDVLYGRV ADFLSWCRQK NDSGLDYQSC. It is sometimes possible for the material contained within the vial of "BST1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.