Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BRWD1 expression in transfected 293T cell line by BRWD1 polyclonal antibody. Lane1: BRWD1 transfected lysate (13.2kD). Lane2: Non-transfected lysate.)

Mouse anti-Human BRWD1 Polyclonal Antibody | anti-Brwd1 antibody

BRWD1 (Bromodomain and WD Repeat-containing Protein 1, C21orf107, FLJ11315, FLJ43918, N143, WDR9, WD Repeat-containing Protein 9)

Gene Names
Brwd1; Wdr9; repro5; G1-403-16; 5330419I02Rik; D530019K20Rik
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
BRWD1; Polyclonal Antibody; BRWD1 (Bromodomain and WD Repeat-containing Protein 1; C21orf107; FLJ11315; FLJ43918; N143; WDR9; WD Repeat-containing Protein 9); Anti -BRWD1 (Bromodomain and WD Repeat-containing Protein 1; anti-Brwd1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BRWD1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI
Applicable Applications for anti-Brwd1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human BRWD1, aa1-120 (NP_001007247.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BRWD1 expression in transfected 293T cell line by BRWD1 polyclonal antibody. Lane1: BRWD1 transfected lysate (13.2kD). Lane2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BRWD1 expression in transfected 293T cell line by BRWD1 polyclonal antibody. Lane1: BRWD1 transfected lysate (13.2kD). Lane2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to BRWD1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to BRWD1 on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-Brwd1 antibody
May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape.
Product Categories/Family for anti-Brwd1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
259,228 Da
NCBI Official Full Name
bromodomain and WD repeat-containing protein 1 isoform C
NCBI Official Synonym Full Names
bromodomain and WD repeat domain containing 1
NCBI Official Symbol
Brwd1
NCBI Official Synonym Symbols
Wdr9; repro5; G1-403-16; 5330419I02Rik; D530019K20Rik
NCBI Protein Information
bromodomain and WD repeat-containing protein 1; WD repeat domain 9; WD repeat-containing protein 9
UniProt Protein Name
Bromodomain and WD repeat-containing protein 1
UniProt Gene Name
Brwd1
UniProt Synonym Gene Names
Wdr9
UniProt Entry Name
BRWD1_MOUSE

Uniprot Description

WDR9: an ubiquitously expressed WD40 repeat protein that may be a transcriptional activator and be involved in chromatin remodeling. Interacts with SMARCA4. WD40 repeats are found in a number of eukaryotic proteins that coordinate multi-protein complex assemblies. WD40 proteins are implicated in many functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. Three alternatively spliced human isoforms have been described.

Protein type: Transcription factor

Cellular Component: cytoplasm; nucleolus; nucleus

Molecular Function: protein binding

Biological Process: regulation of transcription from RNA polymerase II promoter; regulation of cell shape; regulation of transcription, DNA-dependent; transcription, DNA-dependent; cytoskeleton organization and biogenesis

Research Articles on Brwd1

Similar Products

Product Notes

The Brwd1 brwd1 (Catalog #AAA642323) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BRWD1 (Bromodomain and WD Repeat-containing Protein 1, C21orf107, FLJ11315, FLJ43918, N143, WDR9, WD Repeat-containing Protein 9) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BRWD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the Brwd1 brwd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAEPSSARRP VPLIESELYF LIARYLSAGP CRRAAQVLVQ ELEQYQLLPK RLDWEGNEHN RSYEELVLSN KHVAPDHLLQ ICQRIGPMLD KEIPPSISRV TSLLGAGRQS LLRTAKGTLI. It is sometimes possible for the material contained within the vial of "BRWD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.