Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Raji cells, using BRSK1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Rabbit BRSK1 Polyclonal Antibody | anti-BRSK1 antibody

BRSK1 Rabbit pAb

Gene Names
BRSK1; hSAD1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
BRSK1; Polyclonal Antibody; BRSK1 Rabbit pAb; hSAD1; anti-BRSK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERYPSCEDQDLPPRNDVDPPRKRVDSPMLSRHGKRRPERKSMEVLSITDAGGGGSPVPTRRALEMAQHSQRSRSVSGASTGLSSSPLSSPRSPVFSFSPEPGAGDEARGGGSPTSKTQTLPSRGPRGGGAGEQPPPPSARSTPLPGPPGSPR
Applicable Applications for anti-BRSK1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 310-510 of human BRSK1 (NP_115806.1).
Cellular Location
Cell junction, Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center, synapse
Positive Samples
Raji
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Raji cells, using BRSK1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Western Blot (WB) (Western blot analysis of extracts of Raji cells, using BRSK1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat brain using BRSK1 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat brain using BRSK1 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human stomach using BRSK1 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human stomach using BRSK1 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse brain using BRSK1 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded mouse brain using BRSK1 antibody at dilution of 1:100 (40x lens).)
Product Categories/Family for anti-BRSK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85,087 Da
NCBI Official Full Name
serine/threonine-protein kinase BRSK1
NCBI Official Synonym Full Names
BR serine/threonine kinase 1
NCBI Official Symbol
BRSK1
NCBI Official Synonym Symbols
hSAD1
NCBI Protein Information
serine/threonine-protein kinase BRSK1; SAD1 kinase; SAD1 homolog; protein kinase SAD1A; brain-selective kinase 1; SadB kinase short isoform; BR serine/threonine-protein kinase 1; serine/threonine-protein kinase SAD-B; synapses of Amphids Defective homolog
UniProt Protein Name
Serine/threonine-protein kinase BRSK1
UniProt Gene Name
BRSK1
UniProt Synonym Gene Names
KIAA1811; SAD1; SADB; BR serine/threonine-protein kinase 1; SAD1 homolog; hSAD1
UniProt Entry Name
BRSK1_HUMAN

Uniprot Description

BRSK1: a serine/threonine protein kinase of the CAMK group. Closely related to AMPK. Activated by the kinase LKB1. Acts as checkpoint kinase upon DNA damage induced by UV or methyl methane sulfonate. Phosphorylates WEE1 and CDC25B in vitro and CDC25C in vitro and in vivo. Translocates from the cytoplasm to the nucleus in response to UV- or MMS-induced DNA damage. BRSK1 and BRSK2 are required for neuronal polarization. Widely expressed with highest levels in the brain and testis. Two alternatively spliced isoforms have been described.

Protein type: Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.26; EC 2.7.11.1; Protein kinase, CAMK; Kinase, protein; CAMK group; CAMKL family; BRSK subfamily

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: nucleoplasm; centrosome; synaptic vesicle; cytoplasm; cell junction; nucleus

Molecular Function: protein serine/threonine kinase activity; gamma-tubulin binding; tau-protein kinase activity; magnesium ion binding; protein kinase binding; ATP binding

Biological Process: neuron differentiation; axonogenesis; establishment of cell polarity; neurotransmitter secretion; response to ionizing radiation; G2/M transition DNA damage checkpoint; centrosome duplication; response to DNA damage stimulus; protein amino acid phosphorylation; response to UV

Research Articles on BRSK1

Similar Products

Product Notes

The BRSK1 brsk1 (Catalog #AAA9142670) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BRSK1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BRSK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the BRSK1 brsk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PSNGELDPDV LESMASLGCF RDRERLHREL RSEEENQEKM IYYLLLDRKE RYPSCEDQDL PPRNDVDPPR KRVDSPMLSR HGKRRPERKS MEVLSITDAG GGGSPVPTRR ALEMAQHSQR SRSVSGASTG LSSSPLSSPR SPVFSFSPEP GAGDEARGGG SPTSKTQTLP SRGPRGGGAG EQPPPPSARS TPLPGPPGSP R. It is sometimes possible for the material contained within the vial of "BRSK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.