Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Western Blot with Cell line 293T (Embyonic human kidney cells) tissue)

Rabbit BRCA1 Polyclonal Antibody | anti-BRCA1 antibody

BRCA1 antibody - middle region

Gene Names
BRCA1; IRIS; PSCP; BRCAI; BRCC1; FANCS; PNCA4; RNF53; BROVCA1; PPP1R53
Reactivity
Cow, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
BRCA1; Polyclonal Antibody; BRCA1 antibody - middle region; anti-BRCA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
Sequence Length
1863
Applicable Applications for anti-BRCA1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 75%; Human: 100%; Mouse: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BRCA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Western Blot with Cell line 293T (Embyonic human kidney cells) tissue)

Immunohistochemistry (IHC) (Western Blot with Cell line 293T (Embyonic human kidney cells) tissue)

Western Blot (WB)

(WB Suggested Anti-BRCA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-BRCA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Small Intestine)
Related Product Information for anti-BRCA1 antibody
This is a rabbit polyclonal antibody against BRCA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. BRCA1 acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. BRCA1 plays a central role in DNA repair by facilitating cellular response to DNA repair. BRCA1 is required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. BRCA1 is involved in transcriptional regulation of P21 in response to DNA damage. BRCA1 is also required for FANCD2 targeting to sites of DNA damage.It may function as a transcriptional regulator. BRCA1 inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation.This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability and acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as BASC for BRCA1-associated genome surveillance complex. This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complex. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants have been described for this gene but only some have had their full-length natures identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
672
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
208kDa
NCBI Official Full Name
breast cancer type 1 susceptibility protein isoform 1
NCBI Official Synonym Full Names
BRCA1 DNA repair associated
NCBI Official Symbol
BRCA1
NCBI Official Synonym Symbols
IRIS; PSCP; BRCAI; BRCC1; FANCS; PNCA4; RNF53; BROVCA1; PPP1R53
NCBI Protein Information
breast cancer type 1 susceptibility protein
UniProt Protein Name
Breast cancer type 1 susceptibility protein
Protein Family
UniProt Gene Name
BRCA1
UniProt Synonym Gene Names
RNF53
UniProt Entry Name
BRCA1_HUMAN

NCBI Description

This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified. [provided by RefSeq, May 2009]

Uniprot Description

BRCA1: the BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. Plays a central role in DNA repair by facilitating cellular response to DNA repair. Required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. Involved in transcriptional regulation of P21 in response to DNA damage. Required for FANCD2 targeting to sites of DNA damage. May function as a transcriptional regulator. Inhibits lipid synthesis by binding to inactive phosphorylated ACC1 and preventing its dephosphorylation. Defects in BRCA1 are a cause of genetic susceptibility to breast cancer. Mutations in BRCA1 are thought to be responsible for more than 80% of inherited breast-ovarian cancer. Part of the BRCA1-associated genome surveillance complex (BASC), which contains BRCA1, MSH2, MSH6, MLH1, ATM, BLM, PMS2 and the RAD50-MRE11-NBN protein complex. This association may be a dynamic process changing throughout the cell cycle and within subnuclear domains. Interacts (via BRCT domains) with CTIP. Associates with RNA polymerase II holoenzyme. Interacts with SMC1 and COBRA1. Interacts (via BRCT domains) with BRIP1. Interacts with FANCD2 (ubiquitinated). Interacts with BAP1. Interacts with Artemis and claspin. Interacts with H2AFX (phosphorylated on S140). Interacts with CHK1. Interacts with BRCC3. Five human isoforms are produced by alternative splicing and alternative initiation. Isoform 1 and isoform 3 are widely expressed. Isoform 1 is largely nuclear, while isoforms 3 and 5 are cytoplasmic.

Protein type: Ubiquitin conjugating system; Nuclear receptor co-regulator; Transcription, coactivator/corepressor; EC 6.3.2.-; Tumor suppressor; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: nucleoplasm; gamma-tubulin ring complex; condensed nuclear chromosome; protein complex; cytoplasm; BRCA1-BARD1 complex; plasma membrane; chromosome; nucleus; ribonucleoprotein complex; ubiquitin ligase complex

Molecular Function: tubulin binding; protein binding; enzyme binding; DNA binding; androgen receptor binding; zinc ion binding; RNA binding; ubiquitin protein ligase binding; transcription coactivator activity; ubiquitin-protein ligase activity; damaged DNA binding; ligase activity

Biological Process: genetic imprinting; apoptosis; positive regulation of transcription, DNA-dependent; dosage compensation, by inactivation of X chromosome; centrosome cycle; protein ubiquitination; negative regulation of histone H3-K4 methylation; positive regulation of histone H3-K4 methylation; chromosome segregation; negative regulation of histone acetylation; regulation of apoptosis; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; double-strand break repair; DNA replication; negative regulation of fatty acid biosynthetic process; fatty acid biosynthetic process; negative regulation of histone H3-K9 methylation; positive regulation of histone H3-K9 methylation; protein autoubiquitination; positive regulation of DNA repair; chordate embryonic development; postreplication repair; DNA repair; negative regulation of centriole replication; double-strand break repair via homologous recombination; regulation of cell proliferation; regulation of transcription from RNA polymerase II promoter; positive regulation of angiogenesis; DNA damage response, signal transduction resulting in induction of apoptosis; regulation of transcription from RNA polymerase III promoter; positive regulation of protein ubiquitination; response to estrogen stimulus; androgen receptor signaling pathway; positive regulation of histone acetylation; positive regulation of transcription from RNA polymerase II promoter; response to ionizing radiation; G2/M transition DNA damage checkpoint; negative regulation of transcription, DNA-dependent; response to DNA damage stimulus

Disease: Breast-ovarian Cancer, Familial, Susceptibility To, 1; Pancreatic Cancer, Susceptibility To, 4; Breast Cancer

Research Articles on BRCA1

Similar Products

Product Notes

The BRCA1 brca1 (Catalog #AAA3201459) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BRCA1 antibody - middle region reacts with Cow, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BRCA1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the BRCA1 brca1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DDLLDDGEIK EDTSFAENDI KESSAVFSKS VQKGELSRSP SPFTHTHLAQ. It is sometimes possible for the material contained within the vial of "BRCA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.