Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BPISample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human BPI Polyclonal Antibody | anti-BPI antibody

BPI Antibody - N-terminal region

Gene Names
BPI; rBPI; BPIFD1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BPI; Polyclonal Antibody; BPI Antibody - N-terminal region; anti-BPI antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DYSDSFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANI
Sequence Length
487
Applicable Applications for anti-BPI antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BPI
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BPISample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BPISample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BPI antibody
This gene encodes a lipopolysaccharide binding protein. It is associated with human neutrophil granules and has antimicrobial activity against gram-negative organisms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
671
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
bactericidal permeability-increasing protein
NCBI Official Synonym Full Names
bactericidal permeability increasing protein
NCBI Official Symbol
BPI
NCBI Official Synonym Symbols
rBPI; BPIFD1
NCBI Protein Information
bactericidal permeability-increasing protein
UniProt Protein Name
Bactericidal permeability-increasing protein
UniProt Gene Name
BPI
UniProt Synonym Gene Names
BPI
UniProt Entry Name
BPI_HUMAN

NCBI Description

This gene encodes a lipopolysaccharide binding protein. It is associated with human neutrophil granules and has antimicrobial activity against gram-negative organisms. [provided by RefSeq, Nov 2014]

Uniprot Description

BPI: The cytotoxic action of BPI is limited to many species of Gram-negative bacteria; this specificity may be explained by a strong affinity of the very basic N-terminal half for the negatively charged lipopolysaccharides that are unique to the Gram-negative bacterial outer envelope. Has antibacterial activity against the Gram-nagative bacterium P.aeruginosa, this activity is inhibited by LPS from P.aeruginosa. Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.

Protein type: Cell surface; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20q11.23

Cellular Component: integral to plasma membrane; cytoplasm

Molecular Function: lipopolysaccharide binding

Biological Process: negative regulation of interleukin-6 production; negative regulation of interleukin-8 production; immune response; negative regulation of tumor necrosis factor production; negative regulation of macrophage activation; defense response to Gram-negative bacterium

Research Articles on BPI

Similar Products

Product Notes

The BPI bpi (Catalog #AAA3222313) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BPI Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BPI can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BPI bpi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DYSDSFKIKH LGKGHYSFYS MDIREFQLPS SQISMVPNVG LKFSISNANI. It is sometimes possible for the material contained within the vial of "BPI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.