Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BMP4 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Rabbit BMP4 Polyclonal Antibody | anti-BMP4 antibody

BMP4 antibody - N-terminal region

Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BMP4; Polyclonal Antibody; BMP4 antibody - N-terminal region; anti-BMP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQ
Sequence Length
408
Applicable Applications for anti-BMP4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BMP4 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Western Blot (WB) (WB Suggested Anti-BMP4 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)
Related Product Information for anti-BMP4 antibody
This is a rabbit polyclonal antibody against BMP4. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
652
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
bone morphogenetic protein 4 isoform a preproprotein
UniProt Protein Name
Bone morphogenetic protein 4
UniProt Gene Name
BMP4
UniProt Synonym Gene Names
BMP2B; DVR4; BMP-4; BMP-2B
UniProt Entry Name
BMP4_HUMAN

Uniprot Description

BMP4: Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. Homodimer; disulfide-linked. Interacts with GREM2. Part of a complex consisting of TWSG1 and CHRD. Interacts with the serine proteases, HTRA1 and HTRA3; the interaction with either inhibits BMP4-mediated signaling. The HTRA protease activity is required for this inhibition. Interacts with SOSTDC1. Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines. Belongs to the TGF-beta family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 14q22-q23

Cellular Component: proteinaceous extracellular matrix; extracellular space; extracellular region

Molecular Function: heparin binding; protein binding; growth factor activity; cytokine activity; transforming growth factor beta receptor binding; chemoattractant activity

Biological Process: negative regulation of MAP kinase activity; extracellular matrix organization and biogenesis; renal system process; macrophage differentiation; activation of MAPKK activity; positive regulation of apoptosis; positive regulation of transcription, DNA-dependent; negative regulation of chondrocyte differentiation; lymphoid progenitor cell differentiation; telencephalon regionalization; germ cell development; post-embryonic development; regulation of protein import into nucleus; BMP signaling pathway; positive regulation of endothelial cell differentiation; positive chemotaxis; erythrocyte differentiation; chondrocyte differentiation; mesonephros development; kidney development; regulation of odontogenesis of dentine-containing teeth; endochondral ossification; positive regulation of cardiac muscle fiber development; negative regulation of immature T cell proliferation in the thymus; specification of organ position; monocyte differentiation; neuron fate commitment; embryonic cranial skeleton morphogenesis; negative regulation of striated muscle development; branching morphogenesis of a tube; positive regulation of epidermal cell differentiation; negative regulation of mitosis; negative regulation of phosphorylation; hemopoietic progenitor cell differentiation; steroid hormone mediated signaling; positive regulation of endothelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; embryonic digit morphogenesis; negative regulation of transcription, DNA-dependent; alveolus development; positive regulation of epithelial cell proliferation; negative regulation of apoptosis; positive regulation of protein binding; positive regulation of smooth muscle cell proliferation; positive regulation of collagen biosynthetic process; cloacal septation; negative regulation of transcription from RNA polymerase II promoter; embryonic hindlimb morphogenesis; negative regulation of cell cycle; odontogenesis; negative regulation of cell proliferation; smooth muscle development; inner ear receptor cell differentiation; ureteric bud development; intermediate mesodermal cell differentiation; regulation of smooth muscle cell differentiation; positive regulation of BMP signaling pathway; dorsoventral neural tube patterning; negative regulation of epithelial cell proliferation; smoothened signaling pathway; common-partner SMAD protein phosphorylation; negative regulation of T cell differentiation in the thymus; positive regulation of bone mineralization; positive regulation of ossification; odontogenesis of dentine-containing teeth; osteoblast differentiation; positive regulation of osteoblast differentiation; blood vessel endothelial cell proliferation during sprouting angiogenesis; telencephalon development; pituitary gland development; ureteric bud branching; regulation of cell fate commitment; neural tube closure; positive regulation of protein amino acid phosphorylation; negative regulation of myoblast differentiation; positive regulation of neuron differentiation; mesodermal cell fate determination; anterior/posterior axis specification

Disease: Orofacial Cleft 11; Microphthalmia, Syndromic 6

Similar Products

Product Notes

The BMP4 bmp4 (Catalog #AAA3215863) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMP4 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's BMP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BMP4 bmp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HASLIPETGK KKVAEIQGHA GGRRSGQSHE LLRDFEATLL QMFGLRRRPQ. It is sometimes possible for the material contained within the vial of "BMP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.