Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BIKSample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human BIK Polyclonal Antibody | anti-BIK antibody

BIK Antibody - N-terminal region

Gene Names
BIK; BP4; NBK; BIP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BIK; Polyclonal Antibody; BIK Antibody - N-terminal region; anti-BIK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECM
Sequence Length
160
Applicable Applications for anti-BIK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BIK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BIKSample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BIKSample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-BIK antibody
This is a rabbit polyclonal antibody against BIK. It was validated on Western Blot

Target Description: The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins.
Product Categories/Family for anti-BIK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
638
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
bcl-2-interacting killer
NCBI Official Synonym Full Names
BCL2 interacting killer
NCBI Official Symbol
BIK
NCBI Official Synonym Symbols
BP4; NBK; BIP1
NCBI Protein Information
bcl-2-interacting killer
UniProt Protein Name
Bcl-2-interacting killer
Protein Family
UniProt Gene Name
BIK
UniProt Synonym Gene Names
NBK
UniProt Entry Name
BIK_HUMAN

NCBI Description

The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins. [provided by RefSeq, Sep 2011]

Uniprot Description

BIK: accelerates programmed cell death. Binding to the apoptosis repressors Bcl-xL, Bcl-2, or BHRF1 (the Epstein-Barr virus homolog of Bcl-2) suppresses its death-promoting activity. Contains 1 Bcl-2 homology 3 (BH3) domain. Does not interact with Bax.

Protein type: Apoptosis; Mitochondrial; Membrane protein, integral

Chromosomal Location of Human Ortholog: 22q13.31

Cellular Component: mitochondrial membrane; integral to membrane; endomembrane system

Molecular Function: BH domain binding; protein binding; protein heterodimerization activity

Biological Process: apoptotic mitochondrial changes; positive regulation of protein homooligomerization; apoptosis; male gonad development; spermatogenesis

Research Articles on BIK

Similar Products

Product Notes

The BIK bik (Catalog #AAA3220182) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BIK Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BIK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BIK bik for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEVRPLSRDI LMETLLYEQL LEPPTMEVLG MTDSEEDLDP MEDFDSLECM. It is sometimes possible for the material contained within the vial of "BIK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.