Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MLLT10 monoclonal antibody (M02), clone 2B9 Western Blot analysis of MLLT10 expression in Hela S3 NE.)

Mouse MLLT10 Monoclonal Antibody | anti-MLLT10 antibody

MLLT10 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila); Translocated to, 10, AF10, DKFZp686E10210, MGC75086) (Biotin)

Gene Names
MLLT10; AF10
Applications
Western Blot
Purity
Purified
Synonyms
MLLT10; Monoclonal Antibody; MLLT10 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog; Drosophila); Translocated to; 10; AF10; DKFZp686E10210; MGC75086) (Biotin); Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog; MGC75086; anti-MLLT10 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B9
Specificity
Recognizes MLLT10.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-MLLT10 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MLLT10 (NP_001009569, 695aa-793aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSH
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MLLT10 monoclonal antibody (M02), clone 2B9 Western Blot analysis of MLLT10 expression in Hela S3 NE.)

Western Blot (WB) (MLLT10 monoclonal antibody (M02), clone 2B9 Western Blot analysis of MLLT10 expression in Hela S3 NE.)

Western Blot (WB)

(MLLT10 monoclonal antibody (M02), clone 2B9. Western Blot analysis of MLLT10 expression in PC-12.)

Western Blot (WB) (MLLT10 monoclonal antibody (M02), clone 2B9. Western Blot analysis of MLLT10 expression in PC-12.)
Related Product Information for anti-MLLT10 antibody
Mouse monoclonal antibody raised against a partial recombinant MLLT10.
Product Categories/Family for anti-MLLT10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,047 Da
NCBI Official Synonym Full Names
MLLT10 histone lysine methyltransferase DOT1L cofactor
NCBI Official Symbol
MLLT10
NCBI Official Synonym Symbols
AF10
NCBI Protein Information
protein AF-10
UniProt Protein Name
Protein AF-10
Protein Family
UniProt Gene Name
MLLT10
UniProt Synonym Gene Names
AF10
UniProt Entry Name
AF10_HUMAN

NCBI Description

This gene encodes a transcription factor and has been identified as a partner gene involved in several chromosomal rearrangements resulting in various leukemias. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010]

Uniprot Description

MLLT10: Probably involved in transcriptional regulation. In vitro or as fusion protein with MLL has transactivation activity. Binds to cruciform DNA. A chromosomal aberration involving MLLT10 is associated with acute leukemias. Translocation t(10;11)(p12;q23) with MLL/HRX. The result is a rogue activator protein. A chromosomal aberration involving MLLT10 is associated with diffuse histiocytic lymphomas. Translocation t(10;11)(p13;q14) with PICALM. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oncoprotein; Transcription factor

Chromosomal Location of Human Ortholog: 10p12

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; DNA binding; zinc ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter

Disease: Leukemia, Acute Myeloid

Research Articles on MLLT10

Similar Products

Product Notes

The MLLT10 mllt10 (Catalog #AAA6171194) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MLLT10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MLLT10 mllt10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MLLT10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.