Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BECN1Sample Type: HepG2 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit BECN1 Polyclonal Antibody | anti-BECN1 antibody

BECN1 Antibody - N-terminal region

Gene Names
BECN1; ATG6; VPS30; beclin1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BECN1; Polyclonal Antibody; BECN1 Antibody - N-terminal region; anti-BECN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESA
Sequence Length
450
Applicable Applications for anti-BECN1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BECN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BECN1Sample Type: HepG2 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BECN1Sample Type: HepG2 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-BECN1 antibody
This is a rabbit polyclonal antibody against BECN1. It was validated on Western Blot

Target Description: BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.
Product Categories/Family for anti-BECN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
beclin-1 isoform a
NCBI Official Synonym Full Names
beclin 1
NCBI Official Symbol
BECN1
NCBI Official Synonym Symbols
ATG6; VPS30; beclin1
NCBI Protein Information
beclin-1
UniProt Protein Name
Beclin-1
Protein Family
UniProt Gene Name
BECN1
UniProt Synonym Gene Names
GT197
UniProt Entry Name
BECN1_HUMAN

NCBI Description

This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]

Uniprot Description

beclin 1: an essential autophagy protein that has been linked to multiple processes including tumor suppression, protection against some cardiac and neurological degenerative diseases, and lifespan extension. A ubiquitous protein of the beclin family. Is part of the class III PI3K complex that induces autophagy. Expressed at elevated levels in dendrites and cell bodies of cerebellar Purkinje cells. Interacts with the anti-apoptotic protein Bcl-2, which inhibits autophagy when it is present in the endoplasmic reticulum. The dissociation of ATG6 from Bcl-2 is essential for its autophagic activity. Interacts with PITC and GluR-delta2. Probably forms a complex with AMBRA1 and PIK3C3. Plays a role in antiviral host defense. Protects against infection by a neurovirulent strain of Sindbis virus.

Protein type: Adaptor/scaffold; Autophagy; Membrane protein, peripheral

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: extrinsic to membrane; mitochondrion; endoplasmic reticulum; cytoplasmic membrane-bound vesicle; dendrite; phagocytic vesicle; trans-Golgi network; nucleus; endosome

Molecular Function: protein binding; phosphoinositide 3-kinase binding

Biological Process: response to drug; viral reproduction; late endosome to vacuole transport; cytokinesis; CVT pathway; cellular response to nitrogen starvation; negative regulation of cell proliferation; response to vitamin E; lysosome organization and biogenesis; regulation of catalytic activity; beta-amyloid metabolic process; mitochondrion degradation; response to hypoxia; cellular defense response; neuron development; defense response to virus; positive regulation of macroautophagy; positive regulation of autophagy; negative regulation of apoptosis; autophagic vacuole formation

Research Articles on BECN1

Similar Products

Product Notes

The BECN1 becn1 (Catalog #AAA3214089) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BECN1 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BECN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BECN1 becn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLLTTAQAKP GETQEEETNS GEEPFIETPR QDGVSRRFIP PARMMSTESA. It is sometimes possible for the material contained within the vial of "BECN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.