Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: HumanBCL2L1 antibody - N-terminal region validated by WB using 1. H1299 (10ug)2. LO2 (10ug)3. NP361 (10ug)4.-6. HeLA (10ug) at 1:1000.)

Rabbit BCL2L1 Polyclonal Antibody | anti-BCL2L1 antibody

BCL2L1 antibody - N-terminal region

Gene Names
BCL2L1; BCLX; BCL2L; Bcl-X; PPP1R52; BCL-XL/S
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BCL2L1; Polyclonal Antibody; BCL2L1 antibody - N-terminal region; anti-BCL2L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Sequence Length
233
Applicable Applications for anti-BCL2L1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BCL2L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: HumanBCL2L1 antibody - N-terminal region validated by WB using 1. H1299 (10ug)2. LO2 (10ug)3. NP361 (10ug)4.-6. HeLA (10ug) at 1:1000.)

Western Blot (WB) (Sample Type: HumanBCL2L1 antibody - N-terminal region validated by WB using 1. H1299 (10ug)2. LO2 (10ug)3. NP361 (10ug)4.-6. HeLA (10ug) at 1:1000.)
Related Product Information for anti-BCL2L1 antibody
This is a rabbit polyclonal antibody against BCL2L1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BCL2L1 encodes a protein which belongs to the BCL-2 protein family. The proteins encoded by BCL2L1 are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported. The longer isoform acts as an apoptotic inhibitor and the shorter form acts as an apoptotic activator.
Product Categories/Family for anti-BCL2L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
598
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
bcl-2-like protein 1 isoform Bcl-X(L)
NCBI Official Synonym Full Names
BCL2 like 1
NCBI Official Symbol
BCL2L1
NCBI Official Synonym Symbols
BCLX; BCL2L; Bcl-X; PPP1R52; BCL-XL/S
NCBI Protein Information
bcl-2-like protein 1
UniProt Protein Name
Bcl-2-like protein 1
Protein Family
UniProt Gene Name
BCL2L1
UniProt Synonym Gene Names
BCL2L; BCLX; Bcl2-L-1
UniProt Entry Name
B2CL1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator. [provided by RefSeq, Dec 2015]

Uniprot Description

Bcl-xL: an antiapoptotic member of the Bcl-2 family. Located at the outer mitochondrial membrane and regulates outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are potent inducers of cell apoptosis. Two alternatively spliced isoforms have been reported.

Protein type: Mitochondrial; Apoptosis; Membrane protein, integral; Autophagy

Chromosomal Location of Human Ortholog: 20q11.21

Cellular Component: centrosome; nuclear membrane; mitochondrion; synaptic vesicle membrane; integral to membrane; cytosol; mitochondrial outer membrane; mitochondrial matrix; mitochondrial inner membrane; cytoplasm; nucleolus; cell junction; nucleus

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; protein heterodimerization activity; BH3 domain binding; protein kinase binding

Biological Process: negative regulation of autophagy; apoptosis; cytokinesis; cellular process regulating host cell cycle in response to virus; germ cell development; apoptotic mitochondrial changes; regulation of mitochondrial membrane potential; ovarian follicle development; positive regulation of cell proliferation; negative regulation of neuron apoptosis; release of cytochrome c from mitochondria; in utero embryonic development; mitotic cell cycle checkpoint; male gonad development; suppression by virus of host apoptosis; endocytosis; cell proliferation; neuron apoptosis; fertilization; DNA damage response, signal transduction resulting in induction of apoptosis; response to cytokine stimulus; innate immune response; response to cycloheximide; spermatogenesis; regulation of mitochondrial membrane permeability; growth; negative regulation of apoptosis

Research Articles on BCL2L1

Similar Products

Product Notes

The BCL2L1 bcl2l1 (Catalog #AAA3224338) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL2L1 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's BCL2L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BCL2L1 bcl2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSQSNRELVV DFLSYKLSQK GYSWSQFSDV EENRTEAPEG TESEMETPSA. It is sometimes possible for the material contained within the vial of "BCL2L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.