Western Blot (WB)
(Host: RabbitTarget Name: BCAR1Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Rabbit BCAR1 Polyclonal Antibody | anti-BCAR1 antibody
BCAR1 Antibody - C-terminal region
Gene Names
BCAR1; CAS; CAS1; CASS1; CRKAS; P130Cas
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BCAR1; Polyclonal Antibody; BCAR1 Antibody - C-terminal region; anti-BCAR1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPI
Sequence Length
660
Applicable Applications for anti-BCAR1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human BCAR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: BCAR1Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: BCAR1Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-BCAR1 antibody
This is a rabbit polyclonal antibody against BCAR1. It was validated on Western Blot
Target Description: BCAR1, or CAS, is an Src family kinase substrate involved in various cellular events, including migration, survival, transformation, and invasion.
Target Description: BCAR1, or CAS, is an Src family kinase substrate involved in various cellular events, including migration, survival, transformation, and invasion.
Product Categories/Family for anti-BCAR1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
72kDa
NCBI Official Full Name
breast cancer anti-estrogen resistance protein 1 isoform 9
NCBI Official Synonym Full Names
BCAR1 scaffold protein, Cas family member
NCBI Official Symbol
BCAR1
NCBI Official Synonym Symbols
CAS; CAS1; CASS1; CRKAS; P130Cas
NCBI Protein Information
breast cancer anti-estrogen resistance protein 1
Protein Family
NCBI Description
The protein encoded by this gene is a member of the Crk-associated substrate (CAS) family of scaffold proteins, characterized by the presence of multiple protein-protein interaction domains and many serine and tyrosine phosphorylation sites. The encoded protein contains a Src-homology 3 (SH3) domain, a proline-rich domain, a substrate domain which contains 15 repeat of the YxxP consensus phosphorylation motif for Src family kinases, a serine-rich domain, and a bipartite Src-binding domain, which can bind both SH2 and SH3 domains. This adaptor protein functions in multiple cellular pathways, including in cell motility, apoptosis and cell cycle control. Dysregulation of this gene can have a wide range of effects, affecting different pathways, including cardiac development, vascular smooth muscle cells, liver and kidney function, endothelial migration, and cancer. [provided by RefSeq, Sep 2017]
Research Articles on BCAR1
Similar Products
Product Notes
The BCAR1 (Catalog #AAA3215982) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCAR1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BCAR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BCAR1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YVHLQGKEEF EKTQKELLEK GSITRQGKSQ LELQQLKQFE RLEQEVSRPI. It is sometimes possible for the material contained within the vial of "BCAR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
