Rabbit anti-Human, Mouse BCAP31 Polyclonal Antibody | anti-BCAP31 antibody

BCAP31 (B Cell Receptor-associated Protein 31, BCR-associated Protein 31, Bap31, 6C6-AG Tumor-associated Antigen, Protein CDM, p28, BAP31, DXS1357E) (FITC)

Cat. Num. AAA6371060

• Gene Names: BCAP31; CDM; DDCH; BAP31; 6C6-AG; DXS1357E
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BCAP31; Polyclonal Antibody; BCAP31 (B Cell Receptor-associated Protein 31; BCR-associated Protein 31; Bap31; 6C6-AG Tumor-associated Antigen; Protein CDM; p28; BAP31; DXS1357E) (FITC); anti-BCAP31 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human BCAP31. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-BCAP31 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length human BCAP31, aa1-246 (NP_005736.3).
• Immunogen Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(BCAP31 rabbit polyclonal antibody. Western Blot analysis of BCAP31 expression in human spleen.)

Western Blot (WB)

(BCAP31 rabbit polyclonal antibody. Western Blot analysis of BCAP31 expression in mouse intestine.)

Western Blot (WB)

(Western Blot analysis of BCAP31 expression in transfected 293T cell line by BCAP31 polyclonal antibody. Lane 1: BCAP31 transfected lysate (28.0kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-BCAP31 antibody

BAP31 appears to be a multi-functional ER-associated transport protein which was originally identified through its association with membrane IgD in B lymphocytes. Several proteins have since been shown to associate with BAP31, including the Beta2 integrin receptor CD11b/CD18, and nonmuscle gamma-actin and myosin B heavy chain. BAP31 has become a focus area for apoptosis studies due to its association with Bcl-2 and cleavage by initiator caspases including caspase 1 and 8. Cleavage of BAP31 generates a membrane-integrated p20 fragment which is itself a potent inducer of apoptosis when expressed ectopically.

Product Categories/Family for anti-BCAP31 antibody

Antibodies; B Cells

NCBI and Uniprot Product Information

• NCBI GI #: 32171186
• NCBI GeneID: 10134
• NCBI Accession #: NP_005736.3
• NCBI GenBank Nucleotide #: NM_005745
• UniProt Accession #: P51572; Q13836; Q96CF0; B3KQ79; D3DWV5
• Molecular Weight: 34,752 Da
• NCBI Official Full Name: B-cell receptor-associated protein 31 isoform b
• NCBI Official Synonym Full Names: B-cell receptor-associated protein 31
• NCBI Official Symbol: BCAP31
• NCBI Official Synonym Symbols: CDM; DDCH; BAP31; 6C6-AG; DXS1357E
• NCBI Protein Information: B-cell receptor-associated protein 31; p28 Bap31; BCR-associated protein Bap31; 6C6-AG tumor-associated antigen
• UniProt Protein Name: B-cell receptor-associated protein 31
• Protein Family: B-cell receptor-associated protein
• UniProt Gene Name: BCAP31
• UniProt Synonym Gene Names: BAP31; DXS1357E; BCR-associated protein 31; Bap31
• UniProt Entry Name: BAP31_HUMAN

NCBI Description

This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16. [provided by RefSeq, Jan 2012]

Uniprot Description

BCAP31 iso2: May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis. Homodimer and heterodimer with BCAP29. Binds CASP8 (isoform 9) as a complex containing BCAP31, BCAP29, BCL2 and/or BCL2L1. Interacts with VAMP3, VAMP1 and membrane IgD immunoglobulins. May interact with ACTG1 and non-muscle myosin II. Interacts with PTPLB. Ubiquitous. Belongs to the BCAP29/BCAP31 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: endoplasmic reticulum membrane; ER-Golgi intermediate compartment membrane; clathrin-coated vesicle; membrane; endoplasmic reticulum; integral to plasma membrane; lipid particle; cytosol

Molecular Function: protein binding; MHC class I protein binding; protein complex binding

Biological Process: intracellular protein transport; elevation of cytosolic calcium ion concentration; antigen processing and presentation of peptide antigen via MHC class I; ER to Golgi vesicle-mediated transport; apoptosis; reduction of endoplasmic reticulum calcium ion concentration; positive regulation of caspase activity; spermatogenesis; elevation of mitochondrial calcium ion concentration; cell structure disassembly during apoptosis

Disease: Deafness, Dystonia, And Cerebral Hypomyelination