Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (AKT3 monoclonal antibody (M06), clone 2H4 Western Blot analysis of AKT3 expression in MCF-7 (Cat # L046V1).)

Mouse AKT3 Monoclonal Antibody | anti-AKT3 antibody

AKT3 (v-akt murine Thymoma Viral Oncogene Homolog 3 (Protein Kinase B, gamma), DKFZp434N0250, PKB-GAMMA, PKBG, PRKBG, RAC-PK-gamma, RAC-gamma, STK-2) (FITC)

Gene Names
AKT3; MPPH; PKBG; MPPH2; PRKBG; STK-2; PKB-GAMMA; RAC-gamma; RAC-PK-gamma
Applications
Western Blot
Purity
Purified
Synonyms
AKT3; Monoclonal Antibody; AKT3 (v-akt murine Thymoma Viral Oncogene Homolog 3 (Protein Kinase B; gamma); DKFZp434N0250; PKB-GAMMA; PKBG; PRKBG; RAC-PK-gamma; RAC-gamma; STK-2) (FITC); v-akt murine Thymoma Viral Oncogene Homolog 3 (Protein Kinase B; STK-2; anti-AKT3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H4
Specificity
Recognizes AKT3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
479
Applicable Applications for anti-AKT3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AKT3 (AAD29089, 100aa-189aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(AKT3 monoclonal antibody (M06), clone 2H4 Western Blot analysis of AKT3 expression in MCF-7 (Cat # L046V1).)

Western Blot (WB) (AKT3 monoclonal antibody (M06), clone 2H4 Western Blot analysis of AKT3 expression in MCF-7 (Cat # L046V1).)

Western Blot (WB)

(AKT3 monoclonal antibody (M06), clone 2H4. Western Blot analysis of AKT3 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB) (AKT3 monoclonal antibody (M06), clone 2H4. Western Blot analysis of AKT3 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(AKT3 monoclonal antibody (M06), clone 2H4. Western Blot analysis of AKT3 expression in PC-12 (Cat # L012V1).)

Western Blot (WB) (AKT3 monoclonal antibody (M06), clone 2H4. Western Blot analysis of AKT3 expression in PC-12 (Cat # L012V1).)

Western Blot (WB)

(AKT3 monoclonal antibody (M06), clone 2H4. Western Blot analysis of AKT3 expression in Raw 264.7 (Cat # L024V1).)

Western Blot (WB) (AKT3 monoclonal antibody (M06), clone 2H4. Western Blot analysis of AKT3 expression in Raw 264.7 (Cat # L024V1).)
Related Product Information for anti-AKT3 antibody
The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1). Alternatively splice transcript variants encoding distinct isoforms have been described. [provided by RefSeq]
Product Categories/Family for anti-AKT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
protein kinase B gamma
NCBI Official Synonym Full Names
AKT serine/threonine kinase 3
NCBI Official Symbol
AKT3
NCBI Official Synonym Symbols
MPPH; PKBG; MPPH2; PRKBG; STK-2; PKB-GAMMA; RAC-gamma; RAC-PK-gamma
NCBI Protein Information
RAC-gamma serine/threonine-protein kinase

NCBI Description

The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1). Alternatively splice transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]

Research Articles on AKT3

Similar Products

Product Notes

The AKT3 (Catalog #AAA6175073) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AKT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKT3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKT3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.