Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (BAK1 rabbit polyclonal antibody. Western Blot analysis of BAK1 expression in A-431.)

Rabbit anti-Human BAK1 Polyclonal Antibody | anti-BAK1 antibody

BAK1 (Bcl-2 Homologous Antagonist/Killer, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7, BAK, BCL2L7, CDN1) (FITC)

Gene Names
BAK1; BAK; CDN1; BCL2L7; BAK-LIKE
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BAK1; Polyclonal Antibody; BAK1 (Bcl-2 Homologous Antagonist/Killer; Apoptosis Regulator BAK; Bcl-2-like Protein 7; Bcl2-L-7; BAK; BCL2L7; CDN1) (FITC); anti-BAK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BAK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-BAK1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human BAK1, aa1-211 (NP_001179.1).
Immunogen Sequence
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(BAK1 rabbit polyclonal antibody. Western Blot analysis of BAK1 expression in A-431.)

Western Blot (WB) (BAK1 rabbit polyclonal antibody. Western Blot analysis of BAK1 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of BAK1 expression in transfected 293T cell line by BAK1 polyclonal antibody. Lane 1: BAK1 transfected lysate (23.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BAK1 expression in transfected 293T cell line by BAK1 polyclonal antibody. Lane 1: BAK1 transfected lysate (23.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-BAK1 antibody
Bak is a proapoptotic member of the Bcl-2 family. This protein is located on the outer membrane of mitochondria and is an essential component for transduction of apoptotic signals through the mitochondrial pathway. Upon apoptotic stimulation, an upstream stimulator like truncated BID (tBID) induces conformational changes in Bak to form oligomer channels in the mitochondrial membrane for cytochrome c release. The release of cytochrome c to the cytosol activates the caspase-9 pathway and eventually leads to cell death.
Product Categories/Family for anti-BAK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
578
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,409 Da
NCBI Official Full Name
bcl-2 homologous antagonist/killer
NCBI Official Synonym Full Names
BCL2-antagonist/killer 1
NCBI Official Symbol
BAK1
NCBI Official Synonym Symbols
BAK; CDN1; BCL2L7; BAK-LIKE
NCBI Protein Information
bcl-2 homologous antagonist/killer; bcl2-L-7; BCL2-like 7 protein; bcl-2-like protein 7; apoptosis regulator BAK; pro-apoptotic protein BAK
UniProt Protein Name
Bcl-2 homologous antagonist/killer
UniProt Gene Name
BAK1
UniProt Synonym Gene Names
BAK; BCL2L7; CDN1; Bcl2-L-7
UniProt Entry Name
BAK_HUMAN

NCBI Description

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. [provided by RefSeq, Jul 2008]

Uniprot Description

BAK1: In the presence of an appropriate stimulus, accelerates programmed cell death by binding to, and antagonizing the anti- apoptotic action of BCL2 or its adenovirus homolog E1B 19k protein. Low micromolar levels of zinc ions inhibit the promotion of apoptosis. Interacts with BCL2A1. Homodimer. Formation of the homodimer is zinc-dependent. Forms heterodimers with BCL2, E1B 19k protein, and BCL2L1 isoform Bcl-X(L). Interacts with myxoma virus protein M11L. Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle. Belongs to the Bcl-2 family.

Protein type: Membrane protein, integral; Apoptosis; Endoplasmic reticulum; Mitochondrial

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: pore complex; mitochondrial outer membrane; mitochondrion; endoplasmic reticulum; cytosol; integral to mitochondrial outer membrane

Molecular Function: identical protein binding; BH domain binding; protein binding; protein homodimerization activity; protein heterodimerization activity; chaperone binding; heat shock protein binding; metal ion binding

Biological Process: response to fungus; regulation of protein heterodimerization activity; positive regulation of apoptosis; apoptosis; regulation of cell cycle; positive regulation of proteolysis; myeloid cell homeostasis; negative regulation of peptidyl-serine phosphorylation; B cell apoptosis; response to organic cyclic substance; negative regulation of cell proliferation; B cell homeostasis; regulation of mitochondrial membrane potential; response to gamma radiation; establishment and/or maintenance of transmembrane electrochemical gradient; B cell negative selection; aging; response to drug; release of cytochrome c from mitochondria; organ regeneration; mitochondrial fusion; response to mycotoxin; regulation of protein homodimerization activity; vagina development; endocrine pancreas development; limb morphogenesis; response to UV-C; cell proliferation; endoplasmic reticulum calcium ion homeostasis; response to ethanol; unfolded protein response, activation of signaling protein activity; DNA damage response, signal transduction resulting in induction of apoptosis; response to hydrogen peroxide; reduction of endoplasmic reticulum calcium ion concentration; blood vessel remodeling; caspase activation via cytochrome c; brain development; regulation of mitochondrial membrane permeability; post-embryonic camera-type eye morphogenesis

Research Articles on BAK1

Similar Products

Product Notes

The BAK1 bak1 (Catalog #AAA6370983) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BAK1 (Bcl-2 Homologous Antagonist/Killer, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7, BAK, BCL2L7, CDN1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BAK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BAK1 bak1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.