Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BAG5Sample Type: 721_B Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human BAG5 Polyclonal Antibody | anti-BAG5 antibody

BAG5 Antibody - N-terminal region

Gene Names
BAG5; BAG-5
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BAG5; Polyclonal Antibody; BAG5 Antibody - N-terminal region; anti-BAG5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQLFEIDSVDTE
Sequence Length
488
Applicable Applications for anti-BAG5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BAG5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BAG5Sample Type: 721_B Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BAG5Sample Type: 721_B Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-BAG5 antibody
This is a rabbit polyclonal antibody against BAG5. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-BAG5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
BAG family molecular chaperone regulator 5
NCBI Official Synonym Full Names
BCL2 associated athanogene 5
NCBI Official Symbol
BAG5
NCBI Official Synonym Symbols
BAG-5
NCBI Protein Information
BAG family molecular chaperone regulator 5
UniProt Protein Name
BAG family molecular chaperone regulator 5
UniProt Gene Name
BAG5
UniProt Synonym Gene Names
KIAA0873; BAG-5
UniProt Entry Name
BAG5_HUMAN

NCBI Description

The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

BAG5: Inhibits both auto-ubiquitination of PARK2 and ubiquitination of target proteins by PARK2. May function as a nucleotide exchange factor for HSP/HSP70, promoting ADP release, and activating Hsp70-mediated refolding. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 14q32.33

Cellular Component: membrane; mitochondrion; perinuclear region of cytoplasm; inclusion body; nucleus

Molecular Function: protein binding; chaperone binding; ubiquitin protein ligase binding; protein kinase binding

Biological Process: protein folding; negative regulation of ubiquitin-protein ligase activity; negative regulation of protein ubiquitination; negative regulation of proteasomal ubiquitin-dependent protein catabolic process

Research Articles on BAG5

Similar Products

Product Notes

The BAG5 bag5 (Catalog #AAA3219671) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BAG5 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BAG5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BAG5 bag5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISRLQEIQKE VKSVEQQVIG FSGLSDDKNY KKLERILTKQ LFEIDSVDTE. It is sometimes possible for the material contained within the vial of "BAG5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.