Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BAD expression in transfected 293T cell line by BAD polyclonal antibody. Lane 1: BAD transfected lysate (18.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human BAD Polyclonal Antibody | anti-BAD antibody

BAD (Bcl2 Antagonist of Cell Death, Bcl-2-binding Component 6, Bcl-2-like Protein 8, Bcl2-L-8, Bcl-XL/Bcl-2-associated Death Promoter, BBC6, BCL2L8) (AP)

Gene Names
BAD; BBC2; BCL2L8
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BAD; Polyclonal Antibody; BAD (Bcl2 Antagonist of Cell Death; Bcl-2-binding Component 6; Bcl-2-like Protein 8; Bcl2-L-8; Bcl-XL/Bcl-2-associated Death Promoter; BBC6; BCL2L8) (AP); anti-BAD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BAD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-BAD antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human BAD, aa1-168 (NP_004313.1).
Immunogen Sequence
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BAD expression in transfected 293T cell line by BAD polyclonal antibody. Lane 1: BAD transfected lysate (18.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BAD expression in transfected 293T cell line by BAD polyclonal antibody. Lane 1: BAD transfected lysate (18.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between BAD and RAF1. HeLa cells were stained with BAD rabbit purified polyclonal 1:1200 and RAF1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between BAD and RAF1. HeLa cells were stained with BAD rabbit purified polyclonal 1:1200 and RAF1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between BAD and MAPK8 Mahlavu cells were stained with BAD rabbit purified polyclonal 1:1200 and MAPK8 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between BAD and MAPK8 Mahlavu cells were stained with BAD rabbit purified polyclonal 1:1200 and MAPK8 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-BAD antibody
Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain containing pro-apoptotic proteins, such as Bax, Bid, and Bik, form a growing subclass of the Bcl-2 family. Another such protein is the Bcl-2-antagonist of cell death (Bad). Bad regulates apoptosis by forming heterodimers with anti-apoptotic proteins Bcl-2 and Bcl-xL, thereby preventing them from binding with Bax. Bad activity is regulated by its phosphorylation; it is inactivated by kinases such as Akt and MAP kinase and thus promotes cell survival, whereas JNK-induced phosphorylation promotes the apoptotic role of Bad.
Product Categories/Family for anti-BAD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
572
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,392 Da
NCBI Official Full Name
bcl2 antagonist of cell death
NCBI Official Synonym Full Names
BCL2-associated agonist of cell death
NCBI Official Symbol
BAD
NCBI Official Synonym Symbols
BBC2; BCL2L8
NCBI Protein Information
bcl2 antagonist of cell death; bcl2-L-8; BCL2-binding protein; bcl-2-like protein 8; BCL2-binding component 6; bcl-2-binding component 6; BCL-X/BCL-2 binding protein; BCL2-antagonist of cell death protein; bcl-XL/Bcl-2-associated death promoter
UniProt Protein Name
Bcl2 antagonist of cell death
UniProt Gene Name
BAD
UniProt Synonym Gene Names
BBC6; BCL2L8; BAD; Bcl2-L-8
UniProt Entry Name
BAD_HUMAN

NCBI Description

The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq, Jul 2008]

Uniprot Description

BAD: a proapoptotic member of the Bcl-2 family. Displaces Bax from binding to Bcl-2 and Bcl-xL, resulting in cell death. Survival factors such as IL-3 can inhibit the apoptotic activity of Bad inducing the phosphorylation of Bad by Akt and p90RSK. 14-3-3 proteins bind phosphorylated Bad, inhibiting its binding to Bcl-2 and Bcl-xL. Phosphorylation by mitochondria-anchored PKA in the BH3 domain can block the dimerization of Bad and Bcl-xL.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 11q13.1

Cellular Component: mitochondrial outer membrane; mitochondrion; cytosol

Molecular Function: protein kinase B binding; protein binding; protein heterodimerization activity; phospholipid binding; caspase activator activity; protein kinase binding; lipid binding; protein phosphatase 2B binding

Biological Process: response to oleate; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; positive regulation of proteolysis; apoptosis; response to glucocorticoid stimulus; positive regulation of caspase activity; cellular process regulating host cell cycle in response to virus; glucose homeostasis; response to estradiol stimulus; positive regulation of apoptosis by virus; response to glucose stimulus; pore complex biogenesis; positive regulation of autophagy; positive regulation of glucokinase activity; response to drug; caspase activation; epidermal growth factor receptor signaling pathway; release of cytochrome c from mitochondria; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; cytokine and chemokine mediated signaling pathway; suppression by virus of host apoptosis; ADP metabolic process; positive regulation of insulin secretion; response to testosterone stimulus; response to amino acid stimulus; ATP metabolic process; glucose catabolic process; response to ethanol; induction of apoptosis via death domain receptors; DNA damage response, signal transduction resulting in induction of apoptosis; response to hydrogen peroxide; positive regulation of T cell differentiation; positive regulation of B cell differentiation; innate immune response; regulation of mitochondrial membrane permeability; response to calcium ion; response to progesterone stimulus; positive regulation of epithelial cell proliferation

Research Articles on BAD

Similar Products

Product Notes

The BAD bad (Catalog #AAA6370903) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BAD (Bcl2 Antagonist of Cell Death, Bcl-2-binding Component 6, Bcl-2-like Protein 8, Bcl2-L-8, Bcl-XL/Bcl-2-associated Death Promoter, BBC6, BCL2L8) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BAD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BAD bad for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.