Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: B4GT1Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human B4GALT1 Polyclonal Antibody | anti-B4GALT1 antibody

B4GALT1 Antibody - C-terminal region

Gene Names
B4GALT1; GT1; GTB; CDG2D; GGTB2; B4GAL-T1; beta4Gal-T1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
B4GALT1; Polyclonal Antibody; B4GALT1 Antibody - C-terminal region; anti-B4GALT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQ
Sequence Length
398
Applicable Applications for anti-B4GALT1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human B4GT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: B4GT1Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: B4GT1Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-B4GALT1 antibody
This is a rabbit polyclonal antibody against B4GT1. It was validated on Western Blot

Target Description: This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. This gene is unique among the beta4GalT genes because it encodes an enzyme that participates both in glycoconjugate and lactose biosynthesis. For the first activity, the enzyme adds galactose to N-acetylglucosamine residues that are either monosaccharides or the nonreducing ends of glycoprotein carbohydrate chains. The second activity is restricted to lactating mammary tissues where the enzyme forms a heterodimer with alpha-lactalbumin to catalyze UDP-galactose + D-glucose <=> UDP + lactose. The two enzymatic forms result from alternate transcription initiation sites and post-translational processing. Two transcripts, which differ only at the 5' end, with approximate lengths of 4.1 kb and 3.9 kb encode the same protein. The longer transcript encodes the type II membrane-bound, trans-Golgi resident protein involved in glycoconjugate biosynthesis. The shorter transcript encodes a protein which is cleaved to form the soluble lactose synthase.
Product Categories/Family for anti-B4GALT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
beta-1,4-galactosyltransferase 1
NCBI Official Synonym Full Names
beta-1,4-galactosyltransferase 1
NCBI Official Symbol
B4GALT1
NCBI Official Synonym Symbols
GT1; GTB; CDG2D; GGTB2; B4GAL-T1; beta4Gal-T1
NCBI Protein Information
beta-1,4-galactosyltransferase 1
UniProt Protein Name
Beta-1,4-galactosyltransferase 1
UniProt Gene Name
B4GALT1
UniProt Synonym Gene Names
GGTB2; Beta-1,4-GalTase 1; Beta4Gal-T1; b4Gal-T1
UniProt Entry Name
B4GT1_HUMAN

NCBI Description

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. This gene is unique among the beta4GalT genes because it encodes an enzyme that participates both in glycoconjugate and lactose biosynthesis. For the first activity, the enzyme adds galactose to N-acetylglucosamine residues that are either monosaccharides or the nonreducing ends of glycoprotein carbohydrate chains. The second activity is restricted to lactating mammary tissues where the enzyme forms a heterodimer with alpha-lactalbumin to catalyze UDP-galactose + D-glucose <=> UDP + lactose. The two enzymatic forms result from alternate transcription initiation sites and post-translational processing. Two transcripts, which differ only at the 5' end, with approximate lengths of 4.1 kb and 3.9 kb encode the same protein. The longer transcript encodes the type II membrane-bound, trans-Golgi resident protein involved in glycoconjugate biosynthesis. The shorter transcript encodes a protein which is cleaved to form the soluble lactose synthase. [provided by RefSeq, Jul 2008]

Uniprot Description

B4GALT1: The Golgi complex form catalyzes the production of lactose in the lactating mammary gland and could also be responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. Defects in B4GALT1 are the cause of congenital disorder of glycosylation type 2D (CDG2D). CDGs are a family of severe inherited diseases caused by a defect in protein N- glycosylation. They are characterized by under-glycosylated serum proteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. Belongs to the glycosyltransferase 7 family. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: EC 2.4.1.90; EC 2.4.1.22; Cell adhesion; Membrane protein, integral; Carbohydrate Metabolism - galactose; Glycan Metabolism - glycosphingolipid biosynthesis - lacto and neolacto series; Cell development/differentiation; Motility/polarity/chemotaxis; EC 2.4.1.38; Glycan Metabolism - keratan sulfate biosynthesis; Glycan Metabolism - N-glycan biosynthesis; Cell surface; Transferase

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: glycocalyx; Golgi apparatus; desmosome; extracellular space; basolateral plasma membrane; brush border membrane; Golgi trans cisterna; integral to membrane; Golgi membrane; membrane; plasma membrane; external side of plasma membrane; filopodium

Molecular Function: beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity; protein homodimerization activity; N-acetyllactosamine synthase activity; manganese ion binding; lactose synthase activity; cytoskeletal protein binding; beta-tubulin binding; UDP-galactosyltransferase activity; galactosyltransferase activity; alpha-tubulin binding

Biological Process: keratan sulfate metabolic process; extracellular matrix organization and biogenesis; glycosaminoglycan metabolic process; positive regulation of epithelial cell proliferation involved in wound healing; oligosaccharide biosynthetic process; positive regulation of apoptosis involved in mammary gland involution; regulation of acrosome reaction; pathogenesis; lactose biosynthetic process; negative regulation of cell proliferation; development of secondary sexual characteristics; mammary gland development; single fertilization; epithelial cell development; penetration of zona pellucida; cell adhesion; Notch signaling pathway; binding of sperm to zona pellucida; protein amino acid N-linked glycosylation; regulation of cell motility; post-translational protein modification; angiogenesis involved in wound healing; multicellular organism reproduction; cellular protein metabolic process; branching morphogenesis of a tube; keratan sulfate biosynthetic process; carbohydrate metabolic process; galactose metabolic process; protein amino acid N-linked glycosylation via asparagine; leukocyte migration; acute inflammatory response

Disease: Congenital Disorder Of Glycosylation, Type Iid

Research Articles on B4GALT1

Similar Products

Product Notes

The B4GALT1 b4galt1 (Catalog #AAA3220276) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The B4GALT1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's B4GALT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the B4GALT1 b4galt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MIRHSRDKKN EPNPQRFDRI AHTKETMLSD GLNSLTYQVL DVQRYPLYTQ. It is sometimes possible for the material contained within the vial of "B4GALT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.