Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: B3GAT3Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human B3GAT3 Polyclonal Antibody | anti-B3GAT3 antibody

B3GAT3 Antibody - middle region

Gene Names
B3GAT3; JDSCD; GLCATI; glcUAT-I
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
B3GAT3; Polyclonal Antibody; B3GAT3 Antibody - middle region; anti-B3GAT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QRNKALDWLRGRGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFEEMRW
Sequence Length
335
Applicable Applications for anti-B3GAT3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human B3GAT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: B3GAT3Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: B3GAT3Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-B3GAT3 antibody
The protein encoded by this gene is a member of the glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product catalyzes the formation of the glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction in the final step of the biosynthesis of the linkage region of proteoglycans. A pseudogene of this gene has been identified on chromosome 3.
Product Categories/Family for anti-B3GAT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 isoform 4
NCBI Official Synonym Full Names
beta-1,3-glucuronyltransferase 3
NCBI Official Symbol
B3GAT3
NCBI Official Synonym Symbols
JDSCD; GLCATI; glcUAT-I
NCBI Protein Information
galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
UniProt Protein Name
Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
UniProt Gene Name
B3GAT3
UniProt Synonym Gene Names
GlcAT-I; GlcUAT-I
UniProt Entry Name
B3GA3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product catalyzes the formation of the glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction in the final step of the biosynthesis of the linkage region of proteoglycans. A pseudogene of this gene has been identified on chromosome 3. [provided by RefSeq, Dec 2013]

Uniprot Description

B3GAT3: Glycosaminoglycans biosynthesis. Involved in forming the linkage tetrasaccharide present in heparan sulfate and chondroitin sulfate. Transfers a glucuronic acid moiety from the uridine diphosphate-glucuronic acid (UDP-GlcUA) to the common linkage region trisaccharide Gal-beta-1,3-Gal-beta-1,4-Xyl covalently bound to a Ser residue at the glycosaminylglycan attachment site of proteoglycans. Can also play a role in the biosynthesis of l2/HNK-1 carbohydrate epitope on glycoproteins. Shows strict specificity for Gal-beta-1,3-Gal-beta-1,4-Xyl, exhibiting negligible incorporation into other galactoside substrates including Galbeta1-3Gal beta1-O-benzyl, Galbeta1-4GlcNAc and Galbeta1-4Glc. Defects in B3GAT3 are the cause of multiple joint dislocations short stature craniofacial dysmorphism and congenital heart defects (JDSSDHD). An autosomal recessive disease characterized by dysmorphic facies, bilateral dislocations of the elbows, hips, and knees, clubfeet, and short stature, as well as cardiovascular defects. Belongs to the glycosyltransferase 43 family.

Protein type: Glycan Metabolism - heparan sulfate biosynthesis; Transferase; EC 2.4.1.135; Membrane protein, integral; Glycan Metabolism - chondroitin sulfate biosynthesis

Chromosomal Location of Human Ortholog: 11q12.3

Cellular Component: Golgi membrane; Golgi apparatus; cis-Golgi network; membrane; integral to membrane

Molecular Function: protein binding; glucuronosyltransferase activity; metal ion binding; galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity

Biological Process: chondroitin sulfate metabolic process; positive regulation of catalytic activity; glycosaminoglycan biosynthetic process; glycosaminoglycan metabolic process; heparan sulfate proteoglycan biosynthetic process; chondroitin sulfate proteoglycan biosynthetic process; carbohydrate metabolic process; protein amino acid glycosylation; pathogenesis; dermatan sulfate proteoglycan biosynthetic process

Disease: Multiple Joint Dislocations, Short Stature, Craniofacial Dysmorphism, And Congenital Heart Defects

Research Articles on B3GAT3

Similar Products

Product Notes

The B3GAT3 b3gat3 (Catalog #AAA3222829) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The B3GAT3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's B3GAT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the B3GAT3 b3gat3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QRNKALDWLR GRGGAVGGEK DPPPPGTQGV VYFADDDNTY SRELFEEMRW. It is sometimes possible for the material contained within the vial of "B3GAT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.