Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Axin1Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Mouse, Human Axin1 Polyclonal Antibody | anti-AXIN1 antibody

Axin1 Antibody - N-terminal region

Gene Names
Axin1; Fu; Kb; Ki; Axin; fused; kinky; knobbly; AI316800
Reactivity
Mouse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Axin1; Polyclonal Antibody; Axin1 Antibody - N-terminal region; anti-AXIN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVGRDQALGARQAERPWPPHSHPSTPEPSVRNDGKRRFMGVRRQGSRGAG
Sequence Length
993
Applicable Applications for anti-AXIN1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Axin1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Axin1Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Axin1Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-AXIN1 antibody
This is a rabbit polyclonal antibody against Axin1. It was validated on Western Blot

Target Description: Axin1 is a component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Axin1 controls dorsoventral patterning via two opposing effects; down-regulates beta-catenin to inhibit the Wnt signaling pathway and ventralize embryos, but also dorsalizes embryos by activating a Wnt-independent JNK signaling pathway. It also facilitates the phosphorylation of APC by GSK3B, facilitates the phosphorylation of TP53 by HIPK2 upon ultraviolet irradiation and enhances TGF-beta signaling by recruiting the RNF111 E3 ubiquitin ligase and promoting the degradation of inhibitory SMAD7.
Product Categories/Family for anti-AXIN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110kDa
NCBI Official Synonym Full Names
axin 1
NCBI Official Symbol
Axin1
NCBI Official Synonym Symbols
Fu; Kb; Ki; Axin; fused; kinky; knobbly; AI316800
NCBI Protein Information
axin-1
UniProt Protein Name
Axin-1
Protein Family
UniProt Gene Name
Axin1
UniProt Synonym Gene Names
Axin; rAxin
UniProt Entry Name
AXIN1_RAT

Uniprot Description

axin 1: is a negative regulator of the Wnt pathway, which is critical in stem cell signaling, morphogenesis, the mesenchymal-epithelial transition, and many cancers. Axin-1 functions as a tumor suppressor. Probably facilitates the phosphorylation of beta-catenin and APC by GSK3B, leading to their ubiquitination and subsequent proteolysis. Wild-type axin 1 can induce apoptosis in hepatocellular and colorectal cancer cells. Is downregulated during progression of esophageal squamous cell carcinoma. Mutation of the axin-1 gene is associated with hepatocellular carcinoma, anaplastic thyroid cancer, medulloblastoma and colorectal cancer. May have a role in oncogenesis in Hodgkin lymphoma. Axin1/2 mediate cross-talk between TGF-beta and Wnt signaling pathways.

Protein type: Tumor suppressor; Adaptor/scaffold

Cellular Component: beta-catenin destruction complex; cell cortex; cytoplasm; cytoplasmic membrane-bound vesicle; cytoplasmic microtubule; cytoplasmic vesicle; Golgi apparatus; lateral plasma membrane; nucleus; perinuclear region of cytoplasm; plasma membrane; postsynaptic density; protein complex

Molecular Function: beta-catenin binding; enzyme binding; GTPase activator activity; identical protein binding; p53 binding; protein binding; protein C-terminus binding; protein complex scaffold; protein domain specific binding; protein homodimerization activity; protein kinase binding; protein self-association; receptor binding; receptor signaling complex scaffold activity; signal transducer activity; SMAD binding; ubiquitin protein ligase binding

Biological Process: activation of JNK activity; activation of protein kinase activity; adult walking behavior; apoptosis; axial mesoderm development; axial mesoderm formation; cell death; cellular protein complex assembly; cytoplasmic microtubule organization and biogenesis; determination of left/right symmetry; dorsal/ventral axis specification; dorsal/ventral pattern formation; embryonic eye morphogenesis; erythrocyte homeostasis; forebrain anterior/posterior pattern formation; hemoglobin metabolic process; in utero embryonic development; muscle cell development; negative regulation of fat cell differentiation; negative regulation of protein metabolic process; negative regulation of Wnt receptor signaling pathway; neurological system process; nucleocytoplasmic transport; olfactory placode formation; optic placode formation; positive regulation of GTPase activity; positive regulation of JNK activity; positive regulation of JNK cascade; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of protein amino acid phosphorylation; positive regulation of protein catabolic process; positive regulation of protein kinase activity; positive regulation of protein ubiquitination; positive regulation of transcription, DNA-dependent; positive regulation of transforming growth factor beta receptor signaling pathway; positive regulation of ubiquitin-protein ligase activity; protein catabolic process; protein homooligomerization; protein polyubiquitination; regulation of protein amino acid phosphorylation; sensory perception of sound; Wnt receptor signaling pathway; Wnt receptor signaling pathway involved in forebrain neuron fate commitment; Wnt receptor signaling pathway through beta-catenin

Research Articles on AXIN1

Similar Products

Product Notes

The AXIN1 axin1 (Catalog #AAA3206591) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Axin1 Antibody - N-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Axin1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AXIN1 axin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVGRDQALGA RQAERPWPPH SHPSTPEPSV RNDGKRRFMG VRRQGSRGAG. It is sometimes possible for the material contained within the vial of "Axin1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.