Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FBXO44Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Rabbit FBXO44 Polyclonal Antibody | anti-FBXO44 antibody

FBXO44 Antibody - middle region

Gene Names
FBXO44; FBG3; FBX30; FBX6A; Fbx44; Fbxo6a
Reactivity
Cow, Guinea Pig, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FBXO44; Polyclonal Antibody; FBXO44 Antibody - middle region; anti-FBXO44 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEG
Sequence Length
255
Applicable Applications for anti-FBXO44 antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human FBXO44
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FBXO44Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FBXO44Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FBXO44 antibody
This is a rabbit polyclonal antibody against FBXO44. It was validated on Western Blot

Target Description: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It is also a member of the NFB42 (neural F Box 42 kDa) family, similar to F-box only protein 2 and F-box only protein 6. Four alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene.
Product Categories/Family for anti-FBXO44 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
F-box only protein 44 isoform 1
NCBI Official Synonym Full Names
F-box protein 44
NCBI Official Symbol
FBXO44
NCBI Official Synonym Symbols
FBG3; FBX30; FBX6A; Fbx44; Fbxo6a
NCBI Protein Information
F-box only protein 44
UniProt Protein Name
F-box only protein 44
Protein Family
UniProt Gene Name
FBXO44
UniProt Synonym Gene Names
FBG3; FBX30; FBX44; FBX6A; FBXO6A
UniProt Entry Name
FBX44_HUMAN

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It is also a member of the NFB42 (neural F Box 42 kDa) family, similar to F-box only protein 2 and F-box only protein 6. Several alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Feb 2015]

Uniprot Description

FBXO44: Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: SCF ubiquitin ligase complex

Molecular Function: protein binding

Research Articles on FBXO44

Similar Products

Product Notes

The FBXO44 fbxo44 (Catalog #AAA3217809) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBXO44 Antibody - middle region reacts with Cow, Guinea Pig, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO44 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FBXO44 fbxo44 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDVNGGDEWK VEDLSRDQRK EFPNDQVKKY FVTSYYTCLK SQVVDLKAEG. It is sometimes possible for the material contained within the vial of "FBXO44, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.