Western Blot (WB)
(Host: RabbitTarget Name: AVENSample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human AVEN Polyclonal Antibody | anti-AVEN antibody
AVEN Antibody - middle region
Gene Names
AVEN; PDCD12
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
AVEN; Polyclonal Antibody; AVEN Antibody - middle region; anti-AVEN antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWD
Sequence Length
362
Applicable Applications for anti-AVEN antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AVEN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: AVENSample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: AVENSample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-AVEN antibody
Protects against apoptosis mediated by Apaf-1.
Product Categories/Family for anti-AVEN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
cell death regulator Aven
NCBI Official Synonym Full Names
apoptosis and caspase activation inhibitor
NCBI Official Symbol
AVEN
NCBI Official Synonym Symbols
PDCD12
NCBI Protein Information
cell death regulator Aven
UniProt Protein Name
Cell death regulator Aven
Protein Family
UniProt Gene Name
AVEN
UniProt Entry Name
AVEN_HUMAN
Uniprot Description
AVEN: Protects against apoptosis mediated by Apaf-1. Binds Apaf-1, BCL-2 and BAD (Bcl-xl). Highly expressed in testis, ovary, thymus, prostate, spleen, small intestine, colon, heart, skeletal muscle, liver, kidney and pancreas.
Protein type: Inhibitor; Apoptosis
Chromosomal Location of Human Ortholog: 15q13.1
Cellular Component: membrane; endomembrane system; intracellular
Molecular Function: protein binding
Biological Process: apoptosis; negative regulation of apoptosis
Research Articles on AVEN
Similar Products
Product Notes
The AVEN aven (Catalog #AAA3221461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AVEN Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AVEN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AVEN aven for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GAPRGSRREP GGWGAGASAP VEDDSDAETY GEENDEQGNY SKRKIVSNWD. It is sometimes possible for the material contained within the vial of "AVEN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
