Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ATRXSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlATRX is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit ATRX Polyclonal Antibody | anti-ATRX antibody

ATRX Antibody - C-terminal region

Gene Names
ATRX; JMS; XH2; XNP; MRX52; RAD54; RAD54L; ZNF-HX
Reactivity
Dog, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATRX; Polyclonal Antibody; ATRX Antibody - C-terminal region; anti-ATRX antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DQSDETSEDDKKQSKKGTEEKKKPSDFKKKVIKMEQQYESSSDGTEKLPE
Sequence Length
1350
Applicable Applications for anti-ATRX antibody
Western Blot (WB)
Homology
Dog: 88%; Human: 100%; Pig: 93%; Rabbit: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATRX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ATRXSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlATRX is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (Host: RabbitTarget Name: ATRXSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlATRX is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-ATRX antibody
This is a rabbit polyclonal antibody against ATRX. It was validated on Western Blot

Target Description: The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
546
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
148kDa
NCBI Official Full Name
transcriptional regulator ATRX isoform 1
NCBI Official Synonym Full Names
ATRX chromatin remodeler
NCBI Official Symbol
ATRX
NCBI Official Synonym Symbols
JMS; XH2; XNP; MRX52; RAD54; RAD54L; ZNF-HX
NCBI Protein Information
transcriptional regulator ATRX
UniProt Protein Name
Transcriptional regulator ATRX
Protein Family
UniProt Gene Name
ATRX
UniProt Synonym Gene Names
RAD54L; XH2; XNP
UniProt Entry Name
ATRX_HUMAN

NCBI Description

The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Mutations in this gene are associated with X-linked syndromes exhibiting cognitive disabilities as well as alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2017]

Uniprot Description

ATRX: a global transcriptional regulator. Belongs to the SNF2 family of proteins, many of which modify gene expression via chromatin remodeling activity. Involved in the developmental silencing of imprinted genes in the brain. Contains one PxVxL motif, which is required for interaction with chromoshadow domains. This motif requires additional residues at -7, -6, +4 and +5 relative to the central V which contact the chromoshadow domain. Constitutive mutations in ATRX are associated with brain, facial, and genital abnormalities, and alpha thalassemia. Acquired mutations in ATRX have been observed in preleukemic conditions. Six alternatively spliced human isoforms have been described.

Protein type: DNA repair, damage; Ubiquitin conjugating system; EC 3.6.4.12; Helicase

Chromosomal Location of Human Ortholog: Xq21.1

Cellular Component: nucleoplasm; PML body; nuclear heterochromatin; nucleus

Molecular Function: protein binding; DNA helicase activity; DNA binding; histone binding; zinc ion binding; chromatin binding; helicase activity; DNA translocase activity; methylated histone residue binding; ATP binding

Biological Process: transcription, DNA-dependent; DNA damage response, signal transduction by p53 class mediator; positive regulation of telomere maintenance; DNA repair; Sertoli cell development; DNA duplex unwinding; replication fork processing; DNA recombination; chromatin remodeling; nucleosome assembly; DNA replication-independent nucleosome assembly; regulation of transcription, DNA-dependent; forebrain development; DNA methylation; spermatogenesis; positive regulation of transcription from RNA polymerase II promoter

Disease: Alpha-thalassemia/mental Retardation Syndrome, X-linked; Mental Retardation-hypotonic Facies Syndrome, X-linked, 1; Alpha-thalassemia Myelodysplasia Syndrome

Research Articles on ATRX

Similar Products

Product Notes

The ATRX atrx (Catalog #AAA3208757) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATRX Antibody - C-terminal region reacts with Dog, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ATRX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATRX atrx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DQSDETSEDD KKQSKKGTEE KKKPSDFKKK VIKMEQQYES SSDGTEKLPE. It is sometimes possible for the material contained within the vial of "ATRX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.