Western Blot (WB)
(WB Suggested Anti-ATP6V0E2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysate)
Rabbit ATP6V0E2 Polyclonal Antibody | anti-ATP6V0E2 antibody
ATP6V0E2 antibody - middle region
Gene Names
ATP6V0E2; C7orf32; ATP6V0E2L
Reactivity
HumanPredicted Reactivity: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATP6V0E2; Polyclonal Antibody; ATP6V0E2 antibody - middle region; anti-ATP6V0E2 antibody
Host
Rabbit
Reactivity
Human
Predicted Reactivity: Human
Predicted Reactivity: Human
Clonality
Polyclonal
Specificity
Isoform 2 & 3 of Q8NHE4
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP
Sequence Length
164
Applicable Applications for anti-ATP6V0E2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0E2
Protein Interactions
RBPMS
Protein Size
164 amino acids
Tissue Tool
Find tissues and cell lines supported by DNA array analysis to express ATP6V0E2.
RNA Seq
Find tissues and cell lines supported by RNA-seq analysis to express ATP6V0E2.
Predicted Homology Based on Immunogen Seq
Human: 100%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ATP6V0E2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ATP6V0E2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: COLO205 cell lysate)
Related Product Information for anti-ATP6V0E2 antibody
This is a rabbit polyclonal antibody against ATP6V0E2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles, clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules. H(+)-ATPases are also found in plasma membranes of specialized cells, where they play roles in urinary acidification, bone resorption, and sperm maturation. Multiple subunits form H(+)-ATPases, with proteins of the V1 class hydrolyzing ATP for energy to transport H+, and proteins of the V0 class forming an integral membrane domain through which H+ is transported. ATP6V0E2 encodes an isoform of the H(+)-ATPase V0 e subunit, an essential proton pump component (Blake-Palmer et al., 2007 [PubMed 17350184]).[supplied by OMIM].
Target Description: Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles, clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules. H(+)-ATPases are also found in plasma membranes of specialized cells, where they play roles in urinary acidification, bone resorption, and sperm maturation. Multiple subunits form H(+)-ATPases, with proteins of the V1 class hydrolyzing ATP for energy to transport H+, and proteins of the V0 class forming an integral membrane domain through which H+ is transported. ATP6V0E2 encodes an isoform of the H(+)-ATPase V0 e subunit, an essential proton pump component (Blake-Palmer et al., 2007 [PubMed 17350184]).[supplied by OMIM].
Product Categories/Family for anti-ATP6V0E2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17-19kDa
NCBI Official Full Name
V-type proton ATPase subunit e 2 isoform 2
NCBI Official Synonym Full Names
ATPase H+ transporting V0 subunit e2
NCBI Official Symbol
ATP6V0E2
NCBI Official Synonym Symbols
C7orf32; ATP6V0E2L
NCBI Protein Information
V-type proton ATPase subunit e 2
UniProt Protein Name
V-type proton ATPase subunit e 2
Protein Family
UniProt Gene Name
ATP6V0E2
UniProt Synonym Gene Names
ATP6V0E2L; C7orf32; V-ATPase subunit e 2
UniProt Entry Name
VA0E2_HUMAN
NCBI Description
Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles, clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules. H(+)-ATPases are also found in plasma membranes of specialized cells, where they play roles in urinary acidification, bone resorption, and sperm maturation. Multiple subunits form H(+)-ATPases, with proteins of the V1 class hydrolyzing ATP for energy to transport H+, and proteins of the V0 class forming an integral membrane domain through which H+ is transported. ATP6V0E2 encodes an isoform of the H(+)-ATPase V0 e subunit, an essential proton pump component (Blake-Palmer et al., 2007 [PubMed 17350184]).[supplied by OMIM, Mar 2008]
Research Articles on ATP6V0E2
Similar Products
Product Notes
The ATP6V0E2 atp6v0e2 (Catalog #AAA3210504) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP6V0E2 antibody - middle region reacts with Human Predicted Reactivity: Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6V0E2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP6V0E2 atp6v0e2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVAPLSLTTP SSGPSPTQLC LVTSSLLLAP RDPDPQGLPG SWKSSQSSQP. It is sometimes possible for the material contained within the vial of "ATP6V0E2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
