ATP2A3 Polyclonal Antibody | anti-ATP2A3 antibody

Anti-ATP2A3 Antibody

Cat. Num. AAA177877

• Gene Names: ATP2A3; SERCA3
• Reactivity: Mouse, Rat; Predicted to work with: Human
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: ATP2A3; Polyclonal Antibody; Anti-ATP2A3 Antibody; Sarcoplasmic/endoplasmic reticulum calcium ATPase 3; Adenosine triphosphatase calcium; AT2A3_HUMAN; ATPase Ca(2+) transporting ubiquitous; ATPase Ca++ transporting ubiquitous; Calcium pump 3; Calcium translocating P type ATPase; Sarco/endoplasmic reticulum Ca2+ ATPase; SERCA 3; SERCA3; SERCA3b; SR Ca(2+) ATPase 3; SR Ca(2+)-ATPase 3; ATPase; Ca++ transporting; ubiquitous; anti-ATP2A3 antibody

• Reactivity: Mouse, Rat; Predicted to work with: Human
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 999

• Applicable Applications for anti-ATP2A3 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- ATP2A3 antibody, Western blottingAll lanes: Anti ATP2A3 at 0.5ug/mlLane 1: Rat Skeletal Muscle Tissue Lysate at 50ugLane 2: Mouse Skeletal Muscle Tissue Lysate at 50ugPredicted bind size: 114KDObserved bind size: 114KD)

Immunohistochemistry (IHC)

(Anti- ATP2A3 antibody, IHC(P)IHC(P): Mouse Thymus Tissue)

Immunohistochemistry (IHC)

(Anti- ATP2A3 antibody,IHC(P)IHC(P): Rat Thymus Tissue)

Related Product Information for anti-ATP2A3 antibody

Description: Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 3(ATP2A3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2. This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells. ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte. What's more, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.

References

1. Dode L, Wuytack F, Kools PF, Baba-Aissa F, Raeymaekers L, Brike F, van de Ven WJ, Casteels R (Nov 1996). 2. Gelebart, P., Kovacs, T., Brouland, J.-P., van Gorp, R., Grossmann, J., Rivard, N., Panis, Y., Martin, V., Bredoux, R., Enouf, J., Papp, B. Expression of endomembrane calcium pumps in colon and gastric cancer cells: induction of SERCA3 expression during differentiation. J. Biol. Chem. 277: 26310-26320, 2002.

NCBI and Uniprot Product Information

• NCBI GI #: 28373103
• NCBI GeneID: 489
• NCBI Accession #: NP_005164.2
• NCBI GenBank Nucleotide #: NM_005173.3
• UniProt Accession #: Q93084; O60900; O60901; O75501; O75502; Q16115; Q6JHX1; Q8TEX5; Q8TEX6; A8MZG0; D3DTJ8
• Molecular Weight: 112,778 Da
• NCBI Official Full Name: sarcoplasmic/endoplasmic reticulum calcium ATPase 3 isoform a
• NCBI Official Synonym Full Names: ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
• NCBI Official Symbol: ATP2A3
• NCBI Official Synonym Symbols: SERCA3
• NCBI Protein Information: sarcoplasmic/endoplasmic reticulum calcium ATPase 3
• UniProt Protein Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
• Protein Family: Sarcoplasmic/endoplasmic reticulum calcium ATPase
• UniProt Gene Name: ATP2A3
• UniProt Synonym Gene Names: SERCA3; SR Ca(2+)-ATPase 3
• UniProt Entry Name: AT2A3_HUMAN

NCBI Description

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP2A3: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, ion channel; Membrane protein, multi-pass; Membrane protein, integral; Hydrolase; EC 3.6.3.8; Endoplasmic reticulum; Transporter

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; integral to plasma membrane; nuclear membrane; sarcoplasmic reticulum; sarcoplasmic reticulum membrane

Molecular Function: ATP binding; calcium-transporting ATPase activity; metal ion binding

Biological Process: calcium ion transport; cellular calcium ion homeostasis; metabolic process; transport