Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ATP1B3 rabbit polyclonal antibody. Western Blot analysis of ATP1B3 expression in PC-12.)

Rabbit anti-Human, Rat ATP1B3 Polyclonal Antibody | anti-ATP1B3 antibody

ATP1B3 (Sodium/Potassium-transporting ATPase Subunit beta-3, Sodium/potassium-dependent ATPase Subunit beta-3, ATPB-3, CD298) (FITC)

Gene Names
ATP1B3; CD298; ATPB-3
Reactivity
Human, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP1B3; Polyclonal Antibody; ATP1B3 (Sodium/Potassium-transporting ATPase Subunit beta-3; Sodium/potassium-dependent ATPase Subunit beta-3; ATPB-3; CD298) (FITC); anti-ATP1B3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ATP1B3. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-ATP1B3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ATP1B3, aa1-279 (NP_001670.1).
Immunogen Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ATP1B3 rabbit polyclonal antibody. Western Blot analysis of ATP1B3 expression in PC-12.)

Western Blot (WB) (ATP1B3 rabbit polyclonal antibody. Western Blot analysis of ATP1B3 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of ATP1B3 expression in transfected 293T cell line by ATP1B3 polyclonal antibody. Lane 1: ATP1B3 transfected lysate (31.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ATP1B3 expression in transfected 293T cell line by ATP1B3 polyclonal antibody. Lane 1: ATP1B3 transfected lysate (31.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ATP1B3 antibody
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-3 subunit is not known.
Product Categories/Family for anti-ATP1B3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
483
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,513 Da
NCBI Official Full Name
sodium/potassium-transporting ATPase subunit beta-3
NCBI Official Synonym Full Names
ATPase, Na+/K+ transporting, beta 3 polypeptide
NCBI Official Symbol
ATP1B3
NCBI Official Synonym Symbols
CD298; ATPB-3
NCBI Protein Information
sodium/potassium-transporting ATPase subunit beta-3; sodium pump subunit beta-3; Na, K-ATPase beta-3 polypeptide; sodium/potassium-dependent ATPase beta-3 subunit; sodium/potassium-dependent ATPase subunit beta-3; sodium/potassium-transporting ATPase beta
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit beta-3
UniProt Gene Name
ATP1B3
UniProt Synonym Gene Names
ATPB-3
UniProt Entry Name
AT1B3_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP1B3: This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-3 subunit is not known. Belongs to the X(+)/potassium ATPases subunit beta family.

Protein type: Membrane protein, integral; Transporter

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: melanosome; plasma membrane; caveola; sodium:potassium-exchanging ATPase complex

Molecular Function: ATPase activator activity; sodium:potassium-exchanging ATPase activity; ATPase binding

Biological Process: cellular sodium ion homeostasis; potassium ion import; protein stabilization; transport; positive regulation of ATPase activity; blood coagulation; cellular potassium ion homeostasis; leukocyte migration; transmembrane transport

Research Articles on ATP1B3

Similar Products

Product Notes

The ATP1B3 atp1b3 (Catalog #AAA6370664) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP1B3 (Sodium/Potassium-transporting ATPase Subunit beta-3, Sodium/potassium-dependent ATPase Subunit beta-3, ATPB-3, CD298) (FITC) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATP1B3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP1B3 atp1b3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP1B3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.