Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human ATP12A Polyclonal Antibody | anti-ATP12A antibody

ATP12A Polyclonal Antibody

Gene Names
ATP12A; HK; ATP1AL1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ATP12A; Polyclonal Antibody; ATP12A Polyclonal Antibody; ATP1AL1; HK; anti-ATP12A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
YFTVYAQEGFLPRTLINLRVEWEKDYVNDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIFQQGLFRNKVIWVGI
Sequence Length
1045
Applicable Applications for anti-ATP12A antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human ATP12A
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Multi-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-ATP12A antibody
The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ATP12A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
479
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115kDa/116kDa
NCBI Official Full Name
potassium-transporting ATPase alpha chain 2 isoform 1
NCBI Official Synonym Full Names
ATPase H+/K+ transporting non-gastric alpha2 subunit
NCBI Official Symbol
ATP12A
NCBI Official Synonym Symbols
HK; ATP1AL1
NCBI Protein Information
potassium-transporting ATPase alpha chain 2
UniProt Protein Name
Potassium-transporting ATPase alpha chain 2
UniProt Gene Name
ATP12A
UniProt Synonym Gene Names
ATP1AL1

NCBI Description

The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

Catalyzes the hydrolysis of ATP coupled with the exchange of H+ and K+ ions across the plasma membrane. Responsible for potassium absorption in various tissues.

Research Articles on ATP12A

Similar Products

Product Notes

The ATP12A atp12a (Catalog #AAA9134377) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP12A Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP12A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the ATP12A atp12a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YFTVYAQEGF LPRTLINLRV EWEKDYVNDL KDSYGQEWTR YQREYLEWTG YTAFFVGILV QQIADLIIRK TRRNSIFQQG LFRNKVIWVG I. It is sometimes possible for the material contained within the vial of "ATP12A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.