Rabbit anti-Human ATG16L1 Polyclonal Antibody | anti-ATG16L1 antibody

ATG16L1 (Autophagy-related Protein 16-1, APG16-like 1, APG16L, UNQ9393/PRO34307, FLJ00045, FLJ10035, FLJ10828, FLJ22677) (HRP)

Cat. Num. AAA6370621

• Gene Names: ATG16L1; IBD10; WDR30; APG16L; ATG16A; ATG16L
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATG16L1; Polyclonal Antibody; ATG16L1 (Autophagy-related Protein 16-1; APG16-like 1; APG16L; UNQ9393/PRO34307; FLJ00045; FLJ10035; FLJ10828; FLJ22677) (HRP); anti-ATG16L1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ATG16L1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-ATG16L1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ATG16L1, aa1-523 (NP_110430.4).
• Immunogen Sequence: MAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ATG16L1 rabbit polyclonal antibody. Western Blot analysis of ATG16L1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of ATG16L1 expression in transfected 293T cell line by ATG16L1 polyclonal antibody. Lane 1: ATG16L1 transfected lysate (58.3kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-ATG16L1 antibody

Antibodies; Autophagy

NCBI and Uniprot Product Information

• NCBI GI #: 109706945
• NCBI GeneID: 55054
• Molecular Weight: 49,486 Da
• NCBI Official Full Name: Homo sapiens ATG16 autophagy related 16-like 1 (S. cerevisiae), mRNA
• NCBI Official Synonym Full Names: autophagy related 16 like 1
• NCBI Official Symbol: ATG16L1
• NCBI Official Synonym Symbols: IBD10; WDR30; APG16L; ATG16A; ATG16L
• NCBI Protein Information: autophagy-related protein 16-1
• Protein Family: Autophagy-related protein

NCBI Description

The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2010]