Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Atf7ipSample Type: Mouse Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Atf7ip Polyclonal Antibody | anti-ATF7IP antibody

Atf7ip Antibody - middle region

Gene Names
Atf7ip; AM; Mcaf1; 2610204M12Rik
Reactivity
Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Atf7ip; Polyclonal Antibody; Atf7ip Antibody - middle region; anti-ATF7IP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSTPEGEKSEKDGKAEEEERVPAEEQPPVRNEFSRRKRSKSEDMDSVESK
Sequence Length
1306
Applicable Applications for anti-ATF7IP antibody
Western Blot (WB)
Homology
Mouse: 100%; Pig: 92%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse Atf7ip
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Atf7ipSample Type: Mouse Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Atf7ipSample Type: Mouse Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ATF7IP antibody
This is a rabbit polyclonal antibody against Atf7ip. It was validated on Western Blot

Target Description: Recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Atf7ip can both act as an activator or a repressor depending on the context. It mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing SETDB1. Atf7ip is required to stimulate histone methyltransferase activity of SETDB1 and facilitate the conversion of dimethylated to trimethylated H3 'Lys-9' (H3K9me3). The complex formed with MBD1 and SETDB1 represses transcription and couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3). Atf7ip may have ATPase activity.
Product Categories/Family for anti-ATF7IP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
138kDa
NCBI Official Full Name
activating transcription factor 7-interacting protein 1
NCBI Official Synonym Full Names
activating transcription factor 7 interacting protein
NCBI Official Symbol
Atf7ip
NCBI Official Synonym Symbols
AM; Mcaf1; 2610204M12Rik
NCBI Protein Information
activating transcription factor 7-interacting protein 1
UniProt Protein Name
Activating transcription factor 7-interacting protein 1
UniProt Gene Name
Atf7ip
UniProt Synonym Gene Names
Mcaf1; mAM
UniProt Entry Name
MCAF1_MOUSE

Research Articles on ATF7IP

Similar Products

Product Notes

The ATF7IP atf7ip (Catalog #AAA3203513) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Atf7ip Antibody - middle region reacts with Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Atf7ip can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATF7IP atf7ip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSTPEGEKSE KDGKAEEEER VPAEEQPPVR NEFSRRKRSK SEDMDSVESK. It is sometimes possible for the material contained within the vial of "Atf7ip, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.