<
Western Blot (WB)
(Sample Type: Mouse KidneyAtf4 antibody - N-terminal region validated by WB using Mouse Kidney at 0.2-1 ug/ml.)
Rabbit Atf4 Polyclonal Antibody | anti-ATF4 antibody
Atf4 antibody - N-terminal region
Gene Names
Atf4; Atf-4; C/ATF; CREB2; TAXREB67
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Atf4; Polyclonal Antibody; Atf4 antibody - N-terminal region; anti-ATF4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
Sequence Length
349
Applicable Applications for anti-ATF4 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Sample Type: Mouse KidneyAtf4 antibody - N-terminal region validated by WB using Mouse Kidney at 0.2-1 ug/ml.)
Western Blot (WB)
(Sample Type: Mouse KidneyAtf4 antibody - N-terminal region validated by WB using Mouse Kidney at 0.2-1 ug/ml.)
Western Blot (WB)
(Host: MouseTarget Name: ATF4Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: ATF4Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ATF4Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ATF4Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-Atf4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Kidney)
Western Blot (WB)
(WB Suggested Anti-Atf4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Kidney)
Related Product Information for anti-ATF4 antibody
This is a rabbit polyclonal antibody against Atf4. It was validated on Western Blot
Target Description: The function of Atf4 remains unknown.
Target Description: The function of Atf4 remains unknown.
Product Categories/Family for anti-ATF4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38kDa
NCBI Official Full Name
cyclic AMP-dependent transcription factor ATF-4
NCBI Official Synonym Full Names
activating transcription factor 4
NCBI Official Symbol
Atf4
NCBI Official Synonym Symbols
Atf-4; C/ATF; CREB2; TAXREB67
NCBI Protein Information
cyclic AMP-dependent transcription factor ATF-4
Protein Family
Research Articles on ATF4
Similar Products
Product Notes
The ATF4 (Catalog #AAA3203880) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Atf4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Atf4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATF4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLAGDLMSPF DQSGLGAEES LGLLDDYLEV AKHLKPHGFS SDKAGSSEWP. It is sometimes possible for the material contained within the vial of "Atf4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
