Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ATAD3BSample Tissue: Human Liver Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ATAD3B Polyclonal Antibody | anti-ATAD3B antibody

ATAD3B Antibody - N-terminal region

Gene Names
ATAD3B; TOB3; AAA-TOB3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATAD3B; Polyclonal Antibody; ATAD3B Antibody - N-terminal region; anti-ATAD3B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAKAARELEHSRYA
Sequence Length
586
Applicable Applications for anti-ATAD3B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ATAD3B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ATAD3BSample Tissue: Human Liver Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATAD3BSample Tissue: Human Liver Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ATAD3B antibody
The protein encoded by this gene is localized to the mitochondrial inner membrane, where it can bind to a highly-related protein, ATAD3A. ATAD3A appears to interact with matrix nucleoid complexes, and the encoded protein negatively regulates that interaction. This gene is expressed almost exclusively in pluripotent embryonic stem cells and some cancer cells. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ATAD3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64 kDa
NCBI Official Full Name
ATPase family AAA domain-containing protein 3B isoform AAA-TOB3l
NCBI Official Synonym Full Names
ATPase family AAA domain containing 3B
NCBI Official Symbol
ATAD3B
NCBI Official Synonym Symbols
TOB3; AAA-TOB3
NCBI Protein Information
ATPase family AAA domain-containing protein 3B
UniProt Protein Name
ATPase family AAA domain-containing protein 3A
UniProt Gene Name
ATAD3A
UniProt Entry Name
ATD3A_HUMAN

NCBI Description

The protein encoded by this gene is localized to the mitochondrial inner membrane, where it can bind to a highly-related protein, ATAD3A. ATAD3A appears to interact with matrix nucleoid complexes, and the encoded protein negatively regulates that interaction. This gene is expressed almost exclusively in pluripotent embryonic stem cells and some cancer cells. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]

Uniprot Description

ATAD3A: Essential for mitochondrial network organization, mitochondrial metabolism and cell growth at organism and cellular level. May play an important in mitochondrial protein synthesis. May also participate in mitochondrial DNA replication. May bind to mitochondrial DNA D-loops and contribute to nucleoid stability. Required for enhanced channeling of cholesterol for hormone- dependent steroidogenesis. Belongs to the AAA ATPase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 1p36.33

Cellular Component: mitochondrion; mitochondrial inner membrane; integral to membrane

Molecular Function: ATP binding

Biological Process: cell growth; negative regulation of apoptosis

Research Articles on ATAD3B

Similar Products

Product Notes

The ATAD3B atad3a (Catalog #AAA3221100) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATAD3B Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATAD3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATAD3B atad3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPPAQPGAEG GGDRGLGDRP APKDKWSNFD PTGLERAAKA ARELEHSRYA. It is sometimes possible for the material contained within the vial of "ATAD3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.