Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ASPH expression in transfected 293T cell line by ASPH MaxPab polyclonal antibody.Lane 1: ASPH transfected lysate(23.80 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human ASPH Polyclonal Antibody | anti-ASPH antibody

ASPH (Aspartate beta-hydroxylase, BAH, CASQ2BP1, HAAH, JCTN, junctin) (Biotin)

Gene Names
ASPH; AAH; BAH; HAAH; JCTN; FDLAB; junctin; CASQ2BP1
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
ASPH; Polyclonal Antibody; ASPH (Aspartate beta-hydroxylase; BAH; CASQ2BP1; HAAH; JCTN; junctin) (Biotin); Aspartate beta-hydroxylase; junctin; anti-ASPH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ASPH.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
210
Applicable Applications for anti-ASPH antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ASPH (NP_115856.1, 1aa-210aa) full-length human protein.
Immunogen Sequence
MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEELKKEKEKPESRKESKNEERKKGKKEDVRKDKKIADADLSRKESPKGKKDREKEKVDLEKSAKTKENRKKSTNMKDVSSKMASRDKDDRKESRSSTRYAHLTKGNTQKRNG
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ASPH expression in transfected 293T cell line by ASPH MaxPab polyclonal antibody.Lane 1: ASPH transfected lysate(23.80 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ASPH expression in transfected 293T cell line by ASPH MaxPab polyclonal antibody.Lane 1: ASPH transfected lysate(23.80 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-ASPH antibody
This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis. [provided by RefSeq]
Product Categories/Family for anti-ASPH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
444
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
aspartyl/asparaginyl beta-hydroxylase isoform d
NCBI Official Synonym Full Names
aspartate beta-hydroxylase
NCBI Official Symbol
ASPH
NCBI Official Synonym Symbols
AAH; BAH; HAAH; JCTN; FDLAB; junctin; CASQ2BP1
NCBI Protein Information
aspartyl/asparaginyl beta-hydroxylase
UniProt Protein Name
Aspartyl/asparaginyl beta-hydroxylase
UniProt Gene Name
ASPH
UniProt Synonym Gene Names
BAH; ASP beta-hydroxylase
UniProt Entry Name
ASPH_HUMAN

NCBI Description

This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis. [provided by RefSeq, Sep 2009]

Uniprot Description

ASPH: Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins. Belongs to the aspartyl/asparaginyl beta-hydroxylase family. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; Membrane protein, integral; EC 1.14.11.16

Chromosomal Location of Human Ortholog: 8q12.1

Cellular Component: endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; sarcoplasmic reticulum lumen; endoplasmic reticulum; integral to membrane; plasma membrane; integral to endoplasmic reticulum membrane

Molecular Function: protein binding; electron carrier activity; structural constituent of muscle; calcium ion binding; structural molecule activity; peptide-aspartate beta-dioxygenase activity

Biological Process: peptidyl-aspartic acid hydroxylation; negative regulation of cell proliferation; activation of store-operated calcium channel activity; muscle contraction; positive regulation of proteolysis; positive regulation of transcription, DNA-dependent; regulation of protein stability; regulation of inositol-1,4,5-triphosphate receptor activity; palate development; detection of calcium ion; pattern specification process; limb morphogenesis; response to ATP

Research Articles on ASPH

Similar Products

Product Notes

The ASPH asph (Catalog #AAA6450521) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASPH (Aspartate beta-hydroxylase, BAH, CASQ2BP1, HAAH, JCTN, junctin) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASPH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASPH asph for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASPH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.