Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ASL rabbit polyclonal antibody. Western Blot analysis of ASL expression in human liver.)

Rabbit anti-Human, Mouse ASL Polyclonal Antibody | anti-ASL antibody

ASL (Arginosuccinase, Argininosuccinate Lyase, ASAL) (PE)

Gene Names
ASL; ASAL
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ASL; Polyclonal Antibody; ASL (Arginosuccinase; Argininosuccinate Lyase; ASAL) (PE); anti-ASL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ASL. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ASL antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ASL, aa1-464 (NP_000039.2).
Immunogen Sequence
MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ASL rabbit polyclonal antibody. Western Blot analysis of ASL expression in human liver.)

Western Blot (WB) (ASL rabbit polyclonal antibody. Western Blot analysis of ASL expression in human liver.)

Western Blot (WB)

(ASL rabbit polyclonal antibody. Western Blot analysis of ASL expression in mouse kidney.)

Western Blot (WB) (ASL rabbit polyclonal antibody. Western Blot analysis of ASL expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of ASL expression in transfected 293T cell line by ASL polyclonal antibody. Lane 1: ASL transfected lysate (51.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ASL expression in transfected 293T cell line by ASL polyclonal antibody. Lane 1: ASL transfected lysate (51.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ASL antibody
ASL is a member of the lyase 1 family. This protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle.
Product Categories/Family for anti-ASL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
435
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,733 Da
NCBI Official Full Name
argininosuccinate lyase isoform 1
NCBI Official Synonym Full Names
argininosuccinate lyase
NCBI Official Symbol
ASL
NCBI Official Synonym Symbols
ASAL
NCBI Protein Information
argininosuccinate lyase; argininosuccinase; arginosuccinase
UniProt Protein Name
Argininosuccinate lyase
UniProt Gene Name
ASL
UniProt Synonym Gene Names
ASAL
UniProt Entry Name
ARLY_HUMAN

NCBI Description

This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

ASL: Defects in ASL are the cause of arginosuccinic aciduria (ARGINSA). An autosomal recessive disorder of the urea cycle. The disease is characterized by mental and physical retardation, liver enlargement, skin lesions, dry and brittle hair showing trichorrhexis nodosa microscopically and fluorescing red, convulsions, and episodic unconsciousness. Belongs to the lyase 1 family. Argininosuccinate lyase subfamily.

Protein type: Lyase; Amino Acid Metabolism - alanine, aspartate and glutamate; EC 4.3.2.1; Amino Acid Metabolism - arginine and proline

Chromosomal Location of Human Ortholog: 7q11.21

Cellular Component: cytoplasm; cytosol

Molecular Function: argininosuccinate lyase activity

Biological Process: arginine catabolic process; arginine biosynthetic process via ornithine; internal protein amino acid acetylation; urea cycle

Disease: Argininosuccinic Aciduria

Research Articles on ASL

Similar Products

Product Notes

The ASL asl (Catalog #AAA6370506) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASL (Arginosuccinase, Argininosuccinate Lyase, ASAL) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ASL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASL asl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.