Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

Rabbit ASGR1 Polyclonal Antibody | anti-ASGR1 antibody

ASGR1 Antibody - middle region

Gene Names
ASGR1; HL-1; ASGPR; ASGPR1; CLEC4H1
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ASGR1; Polyclonal Antibody; ASGR1 Antibody - middle region; anti-ASGR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
Sequence Length
291
Applicable Applications for anti-ASGR1 antibody
Western Blot (WB)
Homology
Cow: 85%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 93%; Rat: 92%; Yeast: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ASGR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Type: 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Type: 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Type: 721_BAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Type: 721_BAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Type: HelaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Type: HelaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Type: HepG2Antibody Dilution: 1.0ug/mlASGR1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Type: HepG2Antibody Dilution: 1.0ug/mlASGR1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Type: Human Fetal KidneyAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Type: Human Fetal KidneyAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ASGR1Sample Type: JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASGR1Sample Type: JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ASGR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-ASGR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-ASGR1 antibody
This is a rabbit polyclonal antibody against ASGR1. It was validated on Western Blot

Target Description: ASGR1 is a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
Product Categories/Family for anti-ASGR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
432
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
asialoglycoprotein receptor 1 isoform a
NCBI Official Synonym Full Names
asialoglycoprotein receptor 1
NCBI Official Symbol
ASGR1
NCBI Official Synonym Symbols
HL-1; ASGPR; ASGPR1; CLEC4H1
NCBI Protein Information
asialoglycoprotein receptor 1
UniProt Protein Name
Asialoglycoprotein receptor 1
UniProt Gene Name
ASGR1
UniProt Synonym Gene Names
CLEC4H1; ASGP-R 1; ASGPR 1; HL-1
UniProt Entry Name
ASGR1_HUMAN

NCBI Description

This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the more abundant major subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

ASGR1: Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 17p13.2

Cellular Component: integral to plasma membrane; extracellular region

Molecular Function: protein binding; protein homodimerization activity; metal ion binding; asialoglycoprotein receptor activity; carbohydrate binding

Biological Process: receptor-mediated endocytosis; cellular response to extracellular stimulus

Research Articles on ASGR1

Similar Products

Product Notes

The ASGR1 asgr1 (Catalog #AAA3201726) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASGR1 Antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ASGR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ASGR1 asgr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RKMKSLESQL EKQQKDLSED HSSLLLHVKQ FVSDLRSLSC QMAALQGNGS. It is sometimes possible for the material contained within the vial of "ASGR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.