Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human Arrestin 1, beta Polyclonal Antibody | anti-ARRB1 antibody

Arrestin 1, beta (ARRB1, Beta-arrestin-1, ARR1, Arrestin beta-1) (MaxLight 550)

Gene Names
ARRB1; ARB1; ARR1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Arrestin 1; beta; Polyclonal Antibody; beta (ARRB1; Beta-arrestin-1; ARR1; Arrestin beta-1) (MaxLight 550); anti-ARRB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ARRB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-ARRB1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ARRB1, aa1-418 (NP_004032.2).
Immunogen Sequence
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ARRB1 antibody
Beta-arrestin 1 is a 418aa containing signaling neurotransmitter that belongs to the arrestin family with an arrestin N-terminal and an arrestin C-terminal domain. A regulator of beta-adrenergic receptor function, Beta-arrestin 1 seems to bind to phosphorylated beta-adrenergic receptors, thereby causing a significant impairment of their capacity to activate G(S) proteins. It is also reported to act as an activator of the lymphoid enhancer factor (LEF) transcription factor. Beta-arrestin 1 plays a crucial role in ubiquitination and down-regulation of the insulin-like growth factor-1 receptor by acting as an adaptor for the MDM2 E3 ligase. Purified beta-arrestin inhibits the signaling function of BARK-phosphorylated beta-adrenergic receptors by more than 75%, but not that of rhodopsin, and is also involved in synaptic transmission in photoreceptor cells. It is widely expressed in most tissues.
Product Categories/Family for anti-ARRB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
408
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,066 Da
NCBI Official Full Name
beta-arrestin-1 isoform A
NCBI Official Synonym Full Names
arrestin, beta 1
NCBI Official Symbol
ARRB1
NCBI Official Synonym Symbols
ARB1; ARR1
NCBI Protein Information
beta-arrestin-1; arrestin 2
UniProt Protein Name
Beta-arrestin-1
Protein Family
UniProt Gene Name
ARRB1
UniProt Synonym Gene Names
ARR1
UniProt Entry Name
ARRB1_HUMAN

NCBI Description

Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described. [provided by RefSeq, Jan 2011]

Uniprot Description

ARRB1: regulates G-protein coupled receptors (GPCR) signaling by mediating both receptor desensitization and resensitization processes. Binds to GRK-phosphorylated receptor and sterically preclude its coupling to the cognate G- protein; the binding appears to require receptor determinants exposed only in the active receptor conformation. Targets many receptors for internalization by acting as endocytic adapters (CLASPs, clathrin-associated sorting proteins). Internalized arrestin-receptor complexes traffic to intracellular endosomes, where they remain uncoupled from G-proteins. Two different modes of arrestin-mediated internalization occur. Beta-arrestins function as multivalent adapter proteins that can switch the GPCR from a G-protein signaling mode that transmits short-lived signals from the plasma membrane via small molecule second messengers and ion channels to a beta-arrestin signaling mode that transmits a distinct set of signals that are initiated as the receptor internalizes and transits the intracellular compartment. Also involved in regulation of receptors other than GPCRs. Involved in Toll-like receptor and IL-1 receptor signaling through the interaction with TRAF6 which prevents TRAF6 autoubiquitination and oligomerization required for activation of NF-kappa-B and JUN. Binds phosphoinositides. Binds inositolhexakisphosphate (InsP6). Involved in IL8-mediated granule release in neutrophils. Interacts with phosphorylated ADRB2 and CHRM2. Interacts with SRC (via the SH3 domain and the protein kinase domain); the interaction is independent of the phosphorylation state of SRC C-terminus. Interacts with RAF1, CHUK, IKBKB and Nik. Interacts with DVL1 and DVL2; the interaction is enhanced by DVL phosphorylation. Interacts with IGF1R. Belongs to the arrestin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: nucleoplasm; Golgi membrane; cytoplasmic vesicle membrane; lysosomal membrane; cytoplasm; plasma membrane; heterotrimeric G-protein complex; coated pit; cytoplasmic vesicle; pseudopodium; cytosol; nucleus; chromatin

Molecular Function: angiotensin receptor binding; enzyme inhibitor activity; insulin-like growth factor receptor binding; protein binding; histone acetyltransferase activity; mitogen-activated protein kinase kinase binding; ubiquitin protein ligase binding; caspase inhibitor activity; transcription factor binding; GTPase activator activity

Biological Process: transcription from RNA polymerase II promoter; proteasomal ubiquitin-dependent protein catabolic process; platelet activation; Notch signaling pathway; positive regulation of protein binding; positive regulation of receptor internalization; positive regulation of Rho protein signal transduction; protein ubiquitination; negative regulation of caspase activity; positive regulation of peptidyl-serine phosphorylation; protein transport; G-protein coupled receptor internalization; inhibition of NF-kappaB transcription factor; negative regulation of interleukin-8 production; negative regulation of interleukin-6 production; phototransduction; stress fiber formation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of protein ubiquitination; positive regulation of histone acetylation; post-Golgi vesicle-mediated transport; positive regulation of protein amino acid phosphorylation; blood coagulation; positive regulation of GTPase activity

Research Articles on ARRB1

Similar Products

Product Notes

The ARRB1 arrb1 (Catalog #AAA6370393) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Arrestin 1, beta (ARRB1, Beta-arrestin-1, ARR1, Arrestin beta-1) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Arrestin 1, beta can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARRB1 arrb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Arrestin 1, beta, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.