Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit ARRB2 Polyclonal Antibody | anti-ARRB2 antibody

ARRB2 Rabbit pAb

Gene Names
ARRB2; ARB2; ARR2; BARR2
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
ARRB2; Polyclonal Antibody; ARRB2 Rabbit pAb; ARB2; ARR2; BARR2; anti-ARRB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMK
Applicable Applications for anti-ARRB2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ARRB2 (NP_004304.1).
Cellular Location
Cell membrane, Cytoplasm, Cytoplasmic vesicle, Membrane, Nucleus, clathrin-coated pit
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-ARRB2 antibody
Background: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
409
Molecular Weight
409
NCBI Official Full Name
Beta-arrestin-2
NCBI Official Synonym Full Names
arrestin, beta 2
NCBI Official Symbol
ARRB2
NCBI Official Synonym Symbols
ARB2; ARR2; BARR2
NCBI Protein Information
beta-arrestin-2; arrestin 3; arrestin beta-2
UniProt Protein Name
Beta-arrestin-2
Protein Family
UniProt Gene Name
ARRB2
UniProt Synonym Gene Names
ARB2; ARR2
UniProt Entry Name
ARRB2_HUMAN

NCBI Description

Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

ARRB2: a member of the arrestin/beta-arrestin protein family. These proteins participate in agonist-mediated desensitization of G-protein-coupled receptors. Acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Expressed at high levels in the CNS and peripheral blood leukocytes.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: postsynaptic membrane; endocytic vesicle; basolateral plasma membrane; postsynaptic density; cytoplasm; plasma membrane; dendritic spine; coated pit; cytoplasmic vesicle; cytosol; nucleus

Molecular Function: angiotensin receptor binding; protein domain specific binding; protein kinase B binding; type 2A serotonin receptor binding; follicle stimulating hormone receptor binding; alpha-1B adrenergic receptor binding; alpha-1A adrenergic receptor binding; protein binding; enzyme binding; G-protein-coupled receptor binding; ubiquitin protein ligase binding; protein complex binding; mitogen-activated protein kinase binding; type 1 angiotensin receptor binding; protein complex scaffold; D1 dopamine receptor binding; receptor binding

Biological Process: transcription from RNA polymerase II promoter; proteasomal ubiquitin-dependent protein catabolic process; follicle-stimulating hormone signaling pathway; positive regulation of receptor internalization; protein ubiquitination; negative regulation of caspase activity; adult walking behavior; protein transport; receptor internalization; transforming growth factor beta receptor signaling pathway; negative regulation of interleukin-6 production; detection of temperature stimulus involved in sensory perception of pain; arrestin mediated desensitization of G-protein coupled receptor protein signaling pathway; platelet activation; negative regulation of interleukin-12 production; Notch signaling pathway; negative regulation of natural killer cell mediated cytotoxicity; positive regulation of synaptic transmission, dopaminergic; negative regulation of tumor necrosis factor production; negative regulation of interleukin-1 beta production; positive regulation of peptidyl-serine phosphorylation; positive regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; G-protein coupled receptor internalization; inhibition of NF-kappaB transcription factor; positive regulation of protein ubiquitination; negative regulation of toll-like receptor signaling pathway; negative regulation of protein ubiquitination; brain development; positive regulation of calcium ion transport; blood coagulation

Research Articles on ARRB2

Similar Products

Product Notes

The ARRB2 arrb2 (Catalog #AAA9142447) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARRB2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARRB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the ARRB2 arrb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NLASSTIVKE GANKEVLGIL VSYRVKVKLV VSRGGDVSVE LPFVLMHPKP HDHIPLPRPQ SAAPETDVPV DTNLIEFDTN YATDDDIVFE DFARLRLKGM K. It is sometimes possible for the material contained within the vial of "ARRB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.