Rabbit anti-Human ARL11 Polyclonal Antibody | anti-ARL11 antibody

ARL11 (ADP-ribosylation Factor-like Protein 11, ADP-ribosylation Factor-like Tumor Suppressor Protein 1, ARLTS1, FLJ33930, MGC17429) (FITC)

Cat. Num. AAA6370334

• Gene Names: ARL11; ARLTS1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ARL11; Polyclonal Antibody; ARL11 (ADP-ribosylation Factor-like Protein 11; ADP-ribosylation Factor-like Tumor Suppressor Protein 1; ARLTS1; FLJ33930; MGC17429) (FITC); anti-ARL11 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ARL11.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-ARL11 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ARL11, aa1-196 (NP_612459.1).
• Immunogen Sequence: MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ARL11 rabbit polyclonal antibody. Western Blot analysis of ARL11 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of ARL11 expression in transfected 293T cell line by ARL11 polyclonal antibody. Lane 1: ARL11 transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ARL11 antibody

May play a role in apoptosis. May act as a tumor suppressor.

Product Categories/Family for anti-ARL11 antibody

Antibodies; Transport Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 19923979
• NCBI GeneID: 115761
• NCBI Accession #: NP_612459.1
• NCBI GenBank Nucleotide #: NM_138450.4
• UniProt Accession #: Q969Q4
• Molecular Weight: 21,391 Da
• NCBI Official Full Name: ADP-ribosylation factor-like protein 11
• NCBI Official Synonym Full Names: ADP-ribosylation factor-like 11
• NCBI Official Symbol: ARL11
• NCBI Official Synonym Symbols: ARLTS1
• NCBI Protein Information: ADP-ribosylation factor-like protein 11; ADP-ribosylation factor-like tumor suppressor protein 1
• UniProt Protein Name: ADP-ribosylation factor-like protein 11
• Protein Family: ADP-ribosylation factor-like protein
• UniProt Gene Name: ARL11
• UniProt Synonym Gene Names: ARLTS1
• UniProt Entry Name: ARL11_HUMAN

NCBI Description

This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers. [provided by RefSeq, May 2010]

Uniprot Description

ARL11: May play a role in apoptosis. May act as a tumor suppressor. Defects in ARL11 may be a cause of susceptibility to chronic lymphocytic leukemia (CLL). Belongs to the small GTPase superfamily. Arf family.

Protein type: G protein, monomeric, ARF; G protein, monomeric

Chromosomal Location of Human Ortholog: 13q14.2

Cellular Component: intracellular

Molecular Function: protein binding; GTP binding

Biological Process: small GTPase mediated signal transduction; hemopoietic progenitor cell differentiation

Disease: Leukemia, Chronic Lymphocytic