Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RHG27Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit ARHGAP27 Polyclonal Antibody | anti-ARHGAP27 antibody

ARHGAP27 Antibody - middle region

Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARHGAP27; Polyclonal Antibody; ARHGAP27 Antibody - middle region; anti-ARHGAP27 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQDKQMLYTNHFTQEQVPVPAPRSIHKSSQDGDTPAQASPPEEKVPAELD
Sequence Length
862
Applicable Applications for anti-ARHGAP27 antibody
Western Blot (WB)
Homology
Cow: 83%; Dog: 86%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 83%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human RHG27
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RHG27Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RHG27Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ARHGAP27 antibody
This is a rabbit polyclonal antibody against RHG27. It was validated on Western Blot

Target Description: This gene encodes a member of a large family of proteins that activate Rho-type guanosine triphosphate (GTP) metabolizing enzymes. The encoded protein may pay a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-ARHGAP27 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
SH3 domain containing 20
UniProt Protein Name
Rho GTPase-activating protein 27
UniProt Gene Name
ARHGAP27
UniProt Synonym Gene Names
CAMGAP1; SH3D20
UniProt Entry Name
RHG27_HUMAN

Uniprot Description

Function: Rho GTPase-activating protein which may be involved in clathrin-mediated endocytosis. GTPase activators for the Rho-type GTPases act by converting them to an inactive GDP-bound state. Has activity toward CDC42 and RAC1

By similarity.

Subunit structure: Interacts with SH3KBP1/CIN85

By similarity.

Subcellular location: Cytoplasm

By similarity. Membrane; Peripheral membrane protein

By similarity.

Tissue specificity: Expressed in germinal center B-cell, spleen, chronic lymphocytic leukemia, pancreatic cancer and lung cancer. Ref.5

Sequence similarities: Contains 1 PH domain.Contains 1 Rho-GAP domain.Contains 1 SH3 domain.Contains 3 WW domains.

Caution: According to HGNC, ARHGAP27 and SH3D20 are 2 separate genes, corresponding to isoform 2 and isoform 4, respectively. However, a rat transcript and paralog proteins with a similar domain structure suggest the existence of a single gene encoding for a protein of 889 residues as displayed here.

Sequence caution: The sequence AAI01389.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAI01390.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAI01391.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Similar Products

Product Notes

The ARHGAP27 arhgap27 (Catalog #AAA3217459) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARHGAP27 Antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGAP27 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARHGAP27 arhgap27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQDKQMLYTN HFTQEQVPVP APRSIHKSSQ DGDTPAQASP PEEKVPAELD. It is sometimes possible for the material contained within the vial of "ARHGAP27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.