Western Blot (WB)
(WB Suggested Anti-ARGFX Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Rabbit anti-Human, Yeast ARGFX Polyclonal Antibody | anti-ARGFX antibody
ARGFX antibody - N-terminal region
Reactivity
Human, Yeast
Applications
Western Blot
Purity
Protein A purified
Synonyms
ARGFX; Polyclonal Antibody; ARGFX antibody - N-terminal region; anti-ARGFX antibody
Host
Rabbit
Reactivity
Human, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFPDRNLQEKLALRLDLPESTVKVWFRNRRFKLKKQQQQQSAKQRNQILP
Sequence Length
315
Applicable Applications for anti-ARGFX antibody
Western Blot (WB)
Homology
Human: 100%; Yeast: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ARGFX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ARGFX Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ARGFX Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-ARGFX antibody
This is a rabbit polyclonal antibody against ARGFX. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. ARGFX gene is a member of the ARGFX homeobox gene family.Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the ARGFX homeobox gene family. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-83 AC069239.16 30152-30234 c 84-198 AC069239.16 27349-27463 c 199-315 AC069239.16 21265-21381 c 316-464 AC069239.16 13100-13248 c 465-5065 AC069239.16 7543-12143 c
Target Description: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. ARGFX gene is a member of the ARGFX homeobox gene family.Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the ARGFX homeobox gene family. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-83 AC069239.16 30152-30234 c 84-198 AC069239.16 27349-27463 c 199-315 AC069239.16 21265-21381 c 316-464 AC069239.16 13100-13248 c 465-5065 AC069239.16 7543-12143 c
Product Categories/Family for anti-ARGFX antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
arginine-fifty homeobox
NCBI Official Synonym Full Names
arginine-fifty homeobox
NCBI Official Symbol
ARGFX
NCBI Protein Information
arginine-fifty homeobox
UniProt Protein Name
Arginine-fifty homeobox
Protein Family
UniProt Gene Name
ARGFX
UniProt Entry Name
ARGFX_HUMAN
NCBI Description
Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the ARGFX homeobox gene family. [provided by RefSeq, Jul 2008]
Uniprot Description
ARGFX: Putative transcription factor. Belongs to the paired homeobox family.
Protein type: DNA-binding; Transcription factor
Chromosomal Location of Human Ortholog: 3q13.33
Cellular Component: nucleus
Molecular Function: sequence-specific DNA binding
Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent
Similar Products
Product Notes
The ARGFX argfx (Catalog #AAA3208611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARGFX antibody - N-terminal region reacts with Human, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ARGFX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARGFX argfx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFPDRNLQEK LALRLDLPES TVKVWFRNRR FKLKKQQQQQ SAKQRNQILP. It is sometimes possible for the material contained within the vial of "ARGFX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
