Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ARG1 expression in transfected 293T cell line by ARG1 polyclonal antibody. Lane 1: ARG1 transfected lysate (34.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human ARG1 Polyclonal Antibody | anti-ARG1 antibody

ARG1 (Arginase-1, Liver-type Arginase, Type I Arginase) APC

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARG1; Polyclonal Antibody; ARG1 (Arginase-1; Liver-type Arginase; Type I Arginase) APC; anti-ARG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ARG1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ARG1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ARG1, aa1-322 (AAH20653.1).
Immunogen Sequence
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ARG1 expression in transfected 293T cell line by ARG1 polyclonal antibody. Lane 1: ARG1 transfected lysate (34.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ARG1 expression in transfected 293T cell line by ARG1 polyclonal antibody. Lane 1: ARG1 transfected lysate (34.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ARG1 antibody
Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.
Product Categories/Family for anti-ARG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
383
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,735 Da
NCBI Official Full Name
Arginase, liver
NCBI Official Synonym Full Names
arginase, liver
NCBI Official Symbol
ARG1
NCBI Protein Information
arginase-1; type I arginase; liver-type arginase
UniProt Protein Name
Arginase-1
Protein Family
UniProt Gene Name
ARG1
UniProt Entry Name
ARGI1_HUMAN

Uniprot Description

ARG1: Homotrimer. By arginine or homoarginine. Belongs to the arginase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - arginine and proline; Hydrolase; EC 3.5.3.1

Chromosomal Location of Human Ortholog: 6q23

Cellular Component: extracellular space; neuron projection; cell soma; cytoplasm; cytosol; nucleus

Molecular Function: manganese ion binding; arginase activity

Biological Process: response to drug; mammary gland involution; maternal process involved in pregnancy; response to herbicide; liver development; response to amino acid stimulus; response to vitamin A; response to manganese ion; response to selenium ion; response to vitamin E; response to cadmium ion; response to zinc ion; response to methylmercury; arginine catabolic process; positive regulation of endothelial cell proliferation; response to axon injury; collagen biosynthetic process; response to amine stimulus; urea cycle; lung development

Disease: Argininemia

Similar Products

Product Notes

The ARG1 arg1 (Catalog #AAA6370222) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARG1 (Arginase-1, Liver-type Arginase, Type I Arginase) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARG1 arg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.