Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human ARFGEF2 Polyclonal Antibody | anti-ARFGEF2 antibody

ARFGEF2 Polyclonal Antibody

Gene Names
ARFGEF2; BIG2; PVNH2; dJ1164I10.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ARFGEF2; Polyclonal Antibody; ARFGEF2 Polyclonal Antibody; BIG2; dJ1164I10.1; PVNH2; anti-ARFGEF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
VIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKEAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGIADDRQSLSSADNLESDAQGHQVAARFSHVL
Sequence Length
1785
Applicable Applications for anti-ARFGEF2 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human ARFGEF2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell junction, Cell projection, Cytoplasm, Cytoplasmic vesicle, Endosome, Golgi apparatus, Membrane, centrosome, cytoskeleton, dendrite, microtubule organizing center, perinuclear region, synapse, trans-Golgi network
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-ARFGEF2 antibody
ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. The protein encoded by this gene is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP and is involved in Golgi transport. It contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition.
Product Categories/Family for anti-ARFGEF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
202kDa
NCBI Official Full Name
brefeldin A-inhibited guanine nucleotide-exchange protein 2
NCBI Official Synonym Full Names
ADP ribosylation factor guanine nucleotide exchange factor 2
NCBI Official Symbol
ARFGEF2
NCBI Official Synonym Symbols
BIG2; PVNH2; dJ1164I10.1
NCBI Protein Information
brefeldin A-inhibited guanine nucleotide-exchange protein 2
UniProt Protein Name
Brefeldin A-inhibited guanine nucleotide-exchange protein 2
UniProt Gene Name
ARFGEF2
UniProt Synonym Gene Names
ARFGEP2; BIG2; Brefeldin A-inhibited GEP 2

NCBI Description

ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. The protein encoded by this gene is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP and is involved in Golgi transport. It contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition. [provided by RefSeq, Jul 2008]

Uniprot Description

Promotes guanine-nucleotide exchange on ARF1 and ARF3 and to a lower extent on ARF5 and ARF6. Promotes the activation of ARF1/ARF5/ARF6 through replacement of GDP with GTP. Involved in the regulation of Golgi vesicular transport. Required for the integrity of the endosomal compartment. Involved in trafficking from the trans-Golgi network (TGN) to endosomes and is required for membrane association of the AP-1 complex and GGA1. Seems to be involved in recycling of the transferrin receptor from recycling endosomes to the plasma membrane. Probably is involved in the exit of GABA(A) receptors from the endoplasmic reticulum. Involved in constitutive release of tumor necrosis factor receptor 1 via exosome-like vesicles; the function seems to involve PKA and specifically PRKAR2B. Proposed to act as A kinase-anchoring protein (AKAP) and may mediate crosstalk between Arf and PKA pathways.

Research Articles on ARFGEF2

Similar Products

Product Notes

The ARFGEF2 arfgef2 (Catalog #AAA9135374) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARFGEF2 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARFGEF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the ARFGEF2 arfgef2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VIQAAAVSPK FVRLKHSQAQ SKPTTPEKTD LTNGEHARSD SGKVSTENGD APRERGSSLS GTDDGAQEVV KDILEDVVTS AIKEAAEKHG LTEPERVLGE LECQECAIPP GVDENSQTNG IADDRQSLSS ADNLESDAQG HQVAARFSHV L. It is sometimes possible for the material contained within the vial of "ARFGEF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.