Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ARFGEF1Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ARFGEF2 Polyclonal Antibody | anti-ARFGEF2 antibody

ARFGEF2 Antibody - middle region

Gene Names
ARFGEF2; BIG2; PVNH2; dJ1164I10.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARFGEF2; Polyclonal Antibody; ARFGEF2 Antibody - middle region; anti-ARFGEF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDVLLDDIFAQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKT
Sequence Length
702
Applicable Applications for anti-ARFGEF2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARFGEF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ARFGEF1Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ARFGEF1Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ARFGEF2 antibody
This is a rabbit polyclonal antibody against ARFGEF1. It was validated on Western Blot

Target Description: ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. The protein encoded by this gene is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP and is involved in Golgi transport. It contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition.
Product Categories/Family for anti-ARFGEF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
brefeldin A-inhibited guanine nucleotide-exchange protein 2
NCBI Official Synonym Full Names
ADP ribosylation factor guanine nucleotide exchange factor 2
NCBI Official Symbol
ARFGEF2
NCBI Official Synonym Symbols
BIG2; PVNH2; dJ1164I10.1
NCBI Protein Information
brefeldin A-inhibited guanine nucleotide-exchange protein 2
UniProt Protein Name
Brefeldin A-inhibited guanine nucleotide-exchange protein 2
UniProt Gene Name
ARFGEF2
UniProt Synonym Gene Names
ARFGEP2; BIG2; Brefeldin A-inhibited GEP 2
UniProt Entry Name
BIG2_HUMAN

NCBI Description

ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. The protein encoded by this gene is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP and is involved in Golgi transport. It contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition. [provided by RefSeq, Jul 2008]

Uniprot Description

ARFGEF2: Promotes guanine-nucleotide exchange on ARF1 and ARF3 and to a lower extend on ARF5 and ARF6. Promotes the activation of ARF1/ARF5/ARF6 through replacement of GDP with GTP. Involved in the regulation of Golgi vesicular transport. Required for the integrity of the endosomal compartment. Involved in trafficking from the trans-Golgi network (TGN) to endosomes and is required for membrane association of the AP-1 complex and GGA1. Seems to be involved in recycling of the transferrin receptor from recycling endosomes to the plasma membrane. Probably is involved in the exit of GABA(A) receptors from the endoplasmic reticulum. Involved in constitutive release of tumor necrosis factor receptor 1 via exosome-like vesicles; the function seems to involve PKA and specifically PRKAR2B. Proposed to act as A kinase-anchoring protein (AKAP) and may mediate crosstalk between Arf and PKA pathways. Defects in ARFGEF2 are the cause of autosomal recessive periventricular nodular heterotopia type 2 (PVNH2); also known as periventricular heterotopia with microcephaly autosomal recessive. PVNH is a developmental disorder characterized by the presence of periventricular nodules of cerebral gray matter, resulting from a failure of neurons to migrate normally from the lateral ventricular proliferative zone, where they are formed, to the cerebral cortex. PVNH2 is an autosomal recessive form characterized by microcephaly (small brain), severe developmental delay and recurrent infections. No anomalies extrinsic to the central nervous system, such as dysmorphic features or grossly abnormal endocrine or other conditions, are associated with PVNH2.

Protein type: GEFs, ARF; GEFs

Chromosomal Location of Human Ortholog: 20q13.13

Cellular Component: Golgi membrane; asymmetric synapse; recycling endosome; membrane; perinuclear region of cytoplasm; cytoplasmic membrane-bound vesicle; dendritic spine; microtubule organizing center; cytoplasmic vesicle; trans-Golgi network; cell junction; cytosol

Molecular Function: protein binding; myosin binding; guanyl-nucleotide exchange factor activity; GABA receptor binding; ARF guanyl-nucleotide exchange factor activity

Biological Process: vesicle-mediated transport; receptor recycling; Golgi to plasma membrane transport; protein transport; exocytosis; endosome organization and biogenesis; endomembrane organization; regulation of ARF protein signal transduction; positive regulation of tumor necrosis factor production; positive regulation of GTPase activity

Disease: Periventricular Heterotopia With Microcephaly, Autosomal Recessive

Research Articles on ARFGEF2

Similar Products

Product Notes

The ARFGEF2 arfgef2 (Catalog #AAA3215305) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARFGEF2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ARFGEF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARFGEF2 arfgef2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDVLLDDIFA QLYWCVQQDN EQLARSGTNC LENVVILNGE KFTLEIWDKT. It is sometimes possible for the material contained within the vial of "ARFGEF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.