Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (IHC Information: Paraffin embedded brain, cerebellum tissue, tested with an antibody Dilution of 5 ug/ml.)

Rabbit ARF6 Polyclonal Antibody | anti-ARF6 antibody

ARF6 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ARF6; Polyclonal Antibody; ARF6 antibody - middle region; anti-ARF6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG
Sequence Length
175
Applicable Applications for anti-ARF6 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARF6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(IHC Information: Paraffin embedded brain, cerebellum tissue, tested with an antibody Dilution of 5 ug/ml.)

Immunohistochemistry (IHC) (IHC Information: Paraffin embedded brain, cerebellum tissue, tested with an antibody Dilution of 5 ug/ml.)

Western Blot (WB)

(WB Suggested Anti-ARF6 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateARF6 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Western Blot (WB) (WB Suggested Anti-ARF6 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateARF6 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-ARF6 antibody
This is a rabbit polyclonal antibody against ARF6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
382
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
ADP-ribosylation factor 6
NCBI Official Synonym Full Names
ADP ribosylation factor 6
NCBI Official Symbol
ARF6
NCBI Protein Information
ADP-ribosylation factor 6
UniProt Protein Name
ADP-ribosylation factor 6
Protein Family
UniProt Gene Name
ARF6
UniProt Entry Name
ARF6_HUMAN

NCBI Description

This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. [provided by RefSeq, Jul 2008]

Uniprot Description

ARF6: GTP-binding protein involved in protein trafficking; regulates endocytic recycling and cytoskeleton remodeling. May modulate vesicle budding and uncoating within the Golgi apparatus. Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in the regulation of dendritic spine development. Contributes to the regulation of dendritic branching and filopodia extension. Interacts with ARHGAP21, ASAP2, HERC1, PIP5K1C and UACA. Interacts with NCS1/FREQ at the plasma membrane. Interacts with RAB11FIP3 and RAB11FIP4. Interacts with USP6 (via Rab-GAP TBC domain). Interacts with ECM29. Interacts with TBC1D24. Belongs to the small GTPase superfamily. Arf family.

Protein type: G protein, monomeric; Motility/polarity/chemotaxis; G protein, monomeric, ARF

Chromosomal Location of Human Ortholog: 14q21.3

Cellular Component: Golgi apparatus; ruffle; filopodium membrane; focal adhesion; membrane; endocytic vesicle; recycling endosome membrane; early endosome; plasma membrane; cell cortex; midbody; endosome; cleavage furrow

Molecular Function: GTPase activity; protein binding; GTP binding; thioesterase binding

Biological Process: myeloid cell apoptosis; metabolic process; regulation of filopodium formation; liver development; cell cycle; vesicle-mediated transport; regulation of Rac protein signal transduction; protein transport; positive regulation of actin filament polymerization; cell division; small GTPase mediated signal transduction; ruffle organization and biogenesis; negative regulation of receptor-mediated endocytosis; cortical actin cytoskeleton organization and biogenesis; cell adhesion; cell motility

Research Articles on ARF6

Similar Products

Product Notes

The ARF6 arf6 (Catalog #AAA3211755) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARF6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ARF6 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ARF6 arf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: REMRDAIILI FANKQDLPDA MKPHEIQEKL GLTRIRDRNW YVQPSCATSG. It is sometimes possible for the material contained within the vial of "ARF6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.